StarFunc result for job id P43358

User Input

>input (317 residues)
MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESA
GPPQSPQGASALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHF
LLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLV
TCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMGVYDGREHTVY
GEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRI
AYPSLREAALLEEEEGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43358	1.000	1.000	2.213E-54	317	1.000	1.000	P43358.pdb.gz	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
2	AFDB:P43355	0.686	0.703	3.557E-40	309	0.751	0.770	P43355.pdb.gz	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
3	AFDB:P43365	0.661	0.667	2.176E-36	314	0.678	0.685	P43365.pdb.gz	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
4	AFDB:P43356	0.654	0.659	6.071E-36	314	0.669	0.675	P43356.pdb.gz	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
5	AFDB:P43357	0.615	0.621	9.047E-36	314	0.675	0.682	P43357.pdb.gz	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
6	AFDB:P43362	0.682	0.686	3.169E-35	315	0.647	0.651	P43362.pdb.gz	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
7	AFDB:P43364	0.618	0.459	4.939E-32	429	0.628	0.464	P43364.pdb.gz	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
8	AFDB:P43363	0.601	0.518	9.893E-30	369	0.539	0.463	P43363.pdb.gz	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
9	AFDB:Q96LZ2	0.431	0.402	5.336E-23	347	0.401	0.366	Q96LZ2.pdb.gz	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
10	AFDB:O15480	0.581	0.534	9.987E-23	346	0.423	0.387	O15480.pdb.gz	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
11	PDB:7qcdE	0.287	0.343	1.256E-4	261	0.107	0.130	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7tveF	0.275	0.317	1.408E-4	270	0.095	0.111	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
13	PDB:7z1mO	0.167	0.111	1.787E-2	570	0.088	0.049	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
14	PDB:5hs7A	0.192	0.494	2.516E-2	102	0.050	0.157	5hs7A.pdb.gz
15	PDB:3cuqA	0.174	0.235	4.202E-2	219	0.107	0.155	3cuqA.pdb.gz
16	PDB:4zzlA	0.203	0.387	5.587E-2	146	0.047	0.103	4zzlA.pdb.gz
17	PDB:6hixBN	0.218	0.306	1.046E-1	214	0.054	0.079	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
18	PDB:6hivBN	0.218	0.306	1.107E-1	214	0.050	0.075	6hivBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:7ajuJJ	0.106	0.151	1.172E-1	199	0.063	0.101	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7d58O	0.215	0.154	1.472E-1	490	0.079	0.051	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43358	0.0	645	317	1.000	1.000	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
2	Q1RN33	0.0	644	317	0.997	0.997	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
3	P43355	6.49e-152	430	309	0.713	0.731	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
4	P43365	3.52e-149	423	314	0.681	0.688	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
5	P43357	8.26e-149	422	314	0.678	0.685	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
6	P43361	4.21e-148	421	318	0.713	0.711	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
7	P43360	5.32e-144	410	314	0.678	0.685	MAGA6_HUMAN Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1
8	Q96E03	3.75e-142	405	314	0.675	0.682	Q96E03_HUMAN Melanoma antigen family A, 2B OS=Homo sapiens OX=9606 GN=MAGEA2B PE=1 SV=1
9	P43356	2.00e-141	403	314	0.672	0.678	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
10	G5E962	4.77e-131	380	400	0.628	0.497	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
11	P43364	1.94e-130	380	429	0.628	0.464	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
12	P43362	3.15e-121	352	315	0.647	0.651	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
13	P43363	4.33e-109	323	369	0.546	0.469	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
14	C9J2X2	1.84e-78	243	295	0.416	0.447	C9J2X2_HUMAN MAGE family member A11 (Fragment) OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
15	O15480	5.32e-78	243	346	0.413	0.379	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
16	Q96M61	2.88e-76	239	343	0.429	0.397	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
17	O15481	1.40e-70	224	346	0.375	0.344	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
18	Q8BQR7	4.11e-69	220	327	0.379	0.367	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
19	Q96LZ2	5.02e-69	220	347	0.360	0.329	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
20	O15479	8.58e-66	211	319	0.325	0.323	MAGB2_HUMAN Melanoma-associated antigen B2 OS=Homo sapiens OX=9606 GN=MAGEB2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11297 DUF3098	96	14.0	Protein of unknown function (DUF3098)
2	PF01454 MAGE	2.8e-11	55.1	MAGE homology domain
3	PF12440 MAGE_N	7.5e-22	89.2	Melanoma associated antigen family N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353379

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217958	0.934	26S proteasome non-ATPase regulatory subunit 10
2	9606.ENSP00000332602	0.863	Cancer/testis antigen 1B
3	9606.ENSP00000469441	0.861	Cancer/testis antigen 1A
4	9606.ENSP00000359382	0.785	Circadian clock protein PASD1
5	9606.ENSP00000453177	0.777	E3 ubiquitin-protein ligase TRIM69
6	9606.ENSP00000471017	0.761	Melanoma-associated antigen 9
7	9606.ENSP00000264926	0.757	E3 ubiquitin-protein ligase RAD18
8	9606.ENSP00000247306	0.727	Belongs to the CTAG/PCC1 family
9	9606.ENSP00000338796	0.727	Synovial sarcoma, X breakpoint 2
10	9606.ENSP00000379873	0.704	HLA class I histocompatibility antigen, A-3 alpha chain
11	9606.ENSP00000445675	0.696	Melanoma antigen preferentially expressed in tumors
12	9606.ENSP00000469011	0.692	Synovial sarcoma, X breakpoint 4
13	9606.ENSP00000469394	0.692	Protein SSX4
14	9606.ENSP00000244096	0.679	Melanoma-associated antigen 10
15	9606.ENSP00000484668	0.677	G antigen 1
16	9606.ENSP00000410943	0.660	Testis-specific Y-encoded-like protein 4
17	9606.ENSP00000366118	0.657	Protein SSX1
18	9606.ENSP00000430494	0.635	Cytochrome b-c1 complex subunit 7
19	9606.ENSP00000470185	0.603	Cancer/testis antigen family 45 member A1
20	9606.ENSP00000355421	0.574	G antigen 2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048519	0.986	negative regulation of biological process
GO:0048523	0.958	negative regulation of cellular process
GO:0019222	0.941	regulation of metabolic process
GO:0048518	0.872	positive regulation of biological process
GO:0048522	0.859	positive regulation of cellular process
GO:0009987	0.853	cellular process
GO:0060255	0.816	regulation of macromolecule metabolic process
GO:0080090	0.795	regulation of primary metabolic process
GO:0051171	0.787	regulation of nitrogen compound metabolic process
GO:0043066	0.787	negative regulation of apoptotic process
GO:0031323	0.612	regulation of cellular metabolic process
GO:0008152	0.534	metabolic process
GO:0031324	0.502	negative regulation of cellular metabolic process
GO:0071704	0.500	organic substance metabolic process
GO:0044238	0.481	primary metabolic process
GO:0006807	0.451	nitrogen compound metabolic process
GO:0010468	0.450	regulation of gene expression
GO:0051726	0.445	regulation of cell cycle
GO:0010556	0.441	regulation of macromolecule biosynthetic process
GO:0031326	0.441	regulation of cellular biosynthetic process
GO:0019219	0.435	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.409	response to stimulus
GO:0043170	0.385	macromolecule metabolic process
GO:2001141	0.385	regulation of RNA biosynthetic process
GO:0006355	0.377	regulation of DNA-templated transcription
GO:0048583	0.333	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0016020	0.941	membrane
GO:0005829	0.937	cytosol
GO:0071944	0.655	cell periphery
GO:0005886	0.555	plasma membrane
GO:0016604	0.383	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]