StarFunc result for job id P43360

User Input

>input (314 residues)
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPD
PPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFL
LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFAT
CLGLSYDGLLGDNQIMPKTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFG
DPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRIS
YPLLHEWALREGEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43357	0.630	0.630	2.943E-46	314	0.959	0.959	P43357.pdb.gz	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
2	AFDB:P43365	0.661	0.661	9.952E-42	314	0.844	0.844	P43365.pdb.gz	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
3	AFDB:P43356	0.629	0.629	2.273E-40	314	0.838	0.838	P43356.pdb.gz	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
4	AFDB:P43355	0.671	0.682	1.352E-36	309	0.675	0.686	P43355.pdb.gz	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
5	AFDB:P43361	0.644	0.636	7.159E-33	318	0.631	0.623	P43361.pdb.gz	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
6	AFDB:P43363	0.598	0.511	3.632E-28	369	0.522	0.444	P43363.pdb.gz	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
7	AFDB:O15480	0.581	0.528	4.933E-23	346	0.360	0.327	O15480.pdb.gz	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
8	AFDB:Q96M61	0.565	0.520	6.590E-23	343	0.369	0.338	Q96M61.pdb.gz	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
9	AFDB:O15481	0.361	0.333	7.841E-23	346	0.385	0.350	O15481.pdb.gz	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
10	AFDB:Q96LZ2	0.437	0.403	3.971E-22	347	0.344	0.311	Q96LZ2.pdb.gz	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
11	PDB:7tveF	0.285	0.326	2.954E-5	270	0.099	0.115	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
12	PDB:7qcdE	0.298	0.353	6.274E-5	261	0.134	0.161	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
13	PDB:7a6hO	0.173	0.120	4.066E-3	512	0.073	0.045	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
14	PDB:7d58O	0.204	0.144	1.223E-2	490	0.099	0.063	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
15	PDB:7z1mO	0.144	0.093	1.731E-2	570	0.080	0.044	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
16	PDB:1z9cC	0.209	0.416	1.943E-2	138	0.038	0.087	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
17	PDB:5h3rA	0.215	0.426	2.596E-2	141	0.045	0.099	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
18	PDB:4zzlA	0.211	0.405	4.373E-2	146	0.032	0.068	4zzlA.pdb.gz
19	PDB:1w7pD	0.155	0.256	4.911E-2	171	0.054	0.099	1w7pD.pdb.gz
20	PDB:1ldjA	0.148	0.072	6.952E-2	725	0.096	0.041	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43356	0.0	514	314	0.838	0.838	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
2	P43357	0.0	617	314	0.959	0.959	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
3	P43360	0.0	640	314	1.000	1.000	MAGA6_HUMAN Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1
4	P43365	0.0	543	314	0.844	0.844	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
5	Q96E03	0.0	516	314	0.841	0.841	Q96E03_HUMAN Melanoma antigen family A, 2B OS=Homo sapiens OX=9606 GN=MAGEA2B PE=1 SV=1
6	Q1RN33	1.04e-147	419	317	0.666	0.659	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
7	P43358	1.45e-147	419	317	0.666	0.659	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
8	P43355	1.28e-133	383	309	0.653	0.663	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
9	P43361	6.26e-127	367	318	0.637	0.629	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
10	G5E962	9.40e-122	357	400	0.599	0.470	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
11	P43364	2.11e-121	357	429	0.599	0.438	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
12	P43362	3.38e-106	314	315	0.586	0.584	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
13	P43363	4.72e-98	295	369	0.529	0.450	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
14	C9J2X2	5.76e-74	231	295	0.401	0.427	C9J2X2_HUMAN MAGE family member A11 (Fragment) OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
15	Q96M61	1.77e-69	221	343	0.408	0.373	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
16	O15481	2.96e-67	216	346	0.398	0.361	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
17	O15480	1.43e-64	209	346	0.373	0.338	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
18	Q96LZ2	1.16e-59	196	347	0.309	0.280	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
19	Q8BQR7	4.79e-59	194	327	0.334	0.321	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
20	Q9UBF1	7.30e-58	192	373	0.328	0.276	MAGC2_HUMAN Melanoma-associated antigen C2 OS=Homo sapiens OX=9606 GN=MAGEC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01454 MAGE	1.4e-13	62.6	MAGE homology domain
2	PF12440 MAGE_N	3.7e-23	93.4	Melanoma associated antigen family N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480637

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359310	0.854	Putative chondrosarcoma-associated gene 1 protein
2	9606.ENSP00000473093	0.827	Melanoma-associated antigen 3
3	9606.ENSP00000377478	0.773	Melanoma-associated antigen 12
4	9606.ENSP00000253024	0.772	Transcription intermediary factor 1-beta
5	9606.ENSP00000247306	0.753	Belongs to the CTAG/PCC1 family
6	9606.ENSP00000355421	0.664	G antigen 2A
7	9606.ENSP00000380321	0.661	Tubby-related protein 3
8	9606.ENSP00000485541	0.661	Melanoma-associated antigen 2
9	9606.ENSP00000469441	0.660	Cancer/testis antigen 1A
10	9606.ENSP00000332602	0.657	Cancer/testis antigen 1B
11	9606.ENSP00000404123	0.641	G antigen 12F
12	9606.ENSP00000349085	0.564	Melanoma-associated antigen 1
13	9606.ENSP00000333487	0.544	Melanoma antigen family A, 2B
14	9606.ENSP00000416249	0.533	G antigen 12G
15	9606.ENSP00000445675	0.508	Melanoma antigen preferentially expressed in tumors
16	9606.ENSP00000430774	0.506	Uncharacterized protein
17	9606.ENSP00000347358	0.505	Melanoma-associated antigen 11
18	9606.ENSP00000402644	0.504	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009894	0.989	regulation of catabolic process
GO:0048523	0.989	negative regulation of cellular process
GO:0009895	0.966	negative regulation of catabolic process
GO:0010506	0.966	regulation of autophagy
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0080090	0.962	regulation of primary metabolic process
GO:0010507	0.961	negative regulation of autophagy
GO:0010468	0.908	regulation of gene expression
GO:0051172	0.896	negative regulation of nitrogen compound metabolic process
GO:0010605	0.895	negative regulation of macromolecule metabolic process
GO:0009987	0.892	cellular process
GO:0008152	0.854	metabolic process
GO:0048518	0.834	positive regulation of biological process
GO:0048583	0.810	regulation of response to stimulus
GO:0019219	0.804	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.778	regulation of RNA metabolic process
GO:0051248	0.769	negative regulation of protein metabolic process
GO:0048585	0.747	negative regulation of response to stimulus
GO:0050790	0.669	regulation of catalytic activity
GO:0051247	0.656	positive regulation of protein metabolic process
GO:0071704	0.622	organic substance metabolic process
GO:0010941	0.592	regulation of cell death
GO:0009889	0.585	regulation of biosynthetic process
GO:0044238	0.578	primary metabolic process
GO:0009968	0.573	negative regulation of signal transduction
GO:0044237	0.551	cellular metabolic process
GO:0045934	0.551	negative regulation of nucleobase-containing compound metabolic process
GO:0006807	0.540	nitrogen compound metabolic process
GO:0051253	0.537	negative regulation of RNA metabolic process
GO:0060548	0.529	negative regulation of cell death
GO:0050896	0.473	response to stimulus
GO:0006355	0.471	regulation of DNA-templated transcription
GO:0043170	0.470	macromolecule metabolic process
GO:0048522	0.439	positive regulation of cellular process
GO:1901564	0.437	organonitrogen compound metabolic process
GO:0045892	0.366	negative regulation of DNA-templated transcription
GO:0080135	0.331	regulation of cellular response to stress
GO:0043066	0.328	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0016020	0.862	membrane
GO:0016604	0.803	nuclear body
GO:0071944	0.703	cell periphery
GO:0005886	0.686	plasma membrane
GO:0012505	0.674	endomembrane system
GO:0005829	0.643	cytosol
GO:0005783	0.323	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]