StarFunc result for job id P43364

User Input

>input (429 residues)
METQFRRGGLGCSPASIKRKKKREDSGDFGLQVSTMFSEDDFQSTERAPYGPQLQWSQDL
PRVQVFREQANLEDRSPRRTQRITGGEQVLWGPITQIFPTVRPADLTRVIMPLEQRSQHC
KPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESF
SPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVK
GLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYD
GIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLT
QNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYED
ALREEGEGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43364	1.000	1.000	5.401E-68	429	1.000	1.000	P43364.pdb.gz	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
2	AFDB:P43363	0.489	0.568	1.612E-33	369	0.420	0.488	P43363.pdb.gz	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
3	AFDB:P43358	0.459	0.618	1.652E-31	317	0.464	0.628	P43358.pdb.gz	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
4	AFDB:P43362	0.459	0.619	8.663E-31	315	0.438	0.597	P43362.pdb.gz	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
5	AFDB:O15480	0.477	0.587	4.847E-27	346	0.310	0.384	O15480.pdb.gz	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
6	AFDB:Q96M61	0.454	0.561	5.345E-26	343	0.303	0.379	Q96M61.pdb.gz	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
7	AFDB:A2A9R3	0.308	0.245	6.037E-23	556	0.240	0.185	A2A9R3.pdb.gz	MAGB4_MOUSE Melanoma-associated antigen B4 OS=Mus musculus OX=10090 GN=Mageb4 PE=1 SV=1
8	AFDB:O15479	0.295	0.392	1.113E-21	319	0.289	0.389	O15479.pdb.gz	MAGB2_HUMAN Melanoma-associated antigen B2 OS=Homo sapiens OX=9606 GN=MAGEB2 PE=1 SV=3
9	AFDB:Q96JG8	0.277	0.163	1.939E-20	741	0.259	0.150	Q96JG8.pdb.gz	MAGD4_HUMAN Melanoma-associated antigen D4 OS=Homo sapiens OX=9606 GN=MAGED4 PE=1 SV=3
10	AFDB:Q9HCI5	0.272	0.126	1.518E-19	957	0.261	0.117	Q9HCI5.pdb.gz	MAGE1_HUMAN Melanoma-associated antigen E1 OS=Homo sapiens OX=9606 GN=MAGEE1 PE=1 SV=2
11	PDB:7qcdE	0.237	0.372	2.478E-6	261	0.086	0.142	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7tveF	0.235	0.358	4.920E-6	270	0.072	0.115	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
13	PDB:7a6hO	0.149	0.131	4.956E-3	512	0.061	0.051	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
14	PDB:3cuqA	0.140	0.250	1.310E-2	219	0.065	0.128	3cuqA.pdb.gz
15	PDB:7mqaSW	0.088	0.176	1.468E-2	195	0.061	0.133	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7d58O	0.147	0.134	2.190E-2	490	0.079	0.069	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
17	PDB:7z1mO	0.123	0.101	2.455E-2	570	0.068	0.051	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
18	PDB:6hixBN	0.158	0.279	7.273E-2	214	0.040	0.079	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:1w7pD	0.128	0.249	8.633E-2	171	0.049	0.123	1w7pD.pdb.gz
20	PDB:1z9cC	0.173	0.441	9.141E-2	138	0.051	0.159	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J2X2	0.0	594	295	0.681	0.990	C9J2X2_HUMAN MAGE family member A11 (Fragment) OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
2	G5E962	0.0	818	400	0.925	0.993	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
3	P43364	0.0	883	429	1.000	1.000	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
4	Q1RN33	9.13e-127	371	317	0.448	0.606	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
5	P43358	4.53e-126	369	317	0.445	0.603	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
6	P43357	1.09e-121	358	314	0.438	0.599	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
7	P43365	1.94e-120	355	314	0.436	0.596	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
8	P43361	6.82e-120	353	318	0.445	0.601	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
9	P43360	1.40e-115	342	314	0.438	0.599	MAGA6_HUMAN Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1
10	P43363	2.15e-115	344	369	0.422	0.491	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
11	Q96E03	5.82e-112	333	314	0.429	0.586	Q96E03_HUMAN Melanoma antigen family A, 2B OS=Homo sapiens OX=9606 GN=MAGEA2B PE=1 SV=1
12	P43356	3.78e-111	331	314	0.427	0.583	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
13	P43362	5.65e-111	330	315	0.438	0.597	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
14	P43355	1.95e-103	311	309	0.420	0.583	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
15	Q96M61	1.56e-86	269	343	0.331	0.414	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
16	O15481	5.16e-82	258	346	0.298	0.370	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
17	O15480	5.66e-79	249	346	0.312	0.387	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
18	Q8BQR7	1.71e-77	245	327	0.303	0.398	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
19	Q96LZ2	3.16e-74	238	347	0.266	0.329	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
20	Q8N7X4	2.66e-66	219	407	0.254	0.268	MAGB6_HUMAN Melanoma-associated antigen B6 OS=Homo sapiens OX=9606 GN=MAGEB6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01454 MAGE	1.8e-09	49.1	MAGE homology domain
2	PF12440 MAGE_N	3.1e-21	87.2	Melanoma associated antigen family N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347358

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363822	0.994	Androgen receptor
2	9606.ENSP00000263253	0.863	Histone acetyltransferase p300
3	9606.ENSP00000362768	0.775	Retinoblastoma-like protein 1
4	9606.ENSP00000399968	0.737	Nuclear receptor coactivator 2
5	9606.ENSP00000273077	0.681	Probable hydrolase PNKD
6	9606.ENSP00000466967	0.677	tRNA (guanine(26)-N(2))-dimethyltransferase
7	9606.ENSP00000325120	0.599	Progesterone receptor
8	9606.ENSP00000345571	0.594	Transcription factor E2F1
9	9606.ENSP00000250457	0.582	Egl nine homolog 3
10	9606.ENSP00000252597	0.553	Usher syndrome type-1C protein-binding protein 1
11	9606.ENSP00000297737	0.540	Zinc finger matrin-type 4
12	9606.ENSP00000480637	0.505	Melanoma-associated antigen 6
13	9606.ENSP00000274026	0.504	Cyclin-A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0048519	0.990	negative regulation of biological process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0048523	0.958	negative regulation of cellular process
GO:0031323	0.954	regulation of cellular metabolic process
GO:0080090	0.934	regulation of primary metabolic process
GO:0048518	0.839	positive regulation of biological process
GO:0009987	0.795	cellular process
GO:0008152	0.776	metabolic process
GO:0009892	0.744	negative regulation of metabolic process
GO:0031324	0.679	negative regulation of cellular metabolic process
GO:0048522	0.660	positive regulation of cellular process
GO:0071704	0.601	organic substance metabolic process
GO:0010468	0.589	regulation of gene expression
GO:0044238	0.540	primary metabolic process
GO:0019219	0.536	regulation of nucleobase-containing compound metabolic process
GO:0006807	0.531	nitrogen compound metabolic process
GO:0031326	0.482	regulation of cellular biosynthetic process
GO:0051252	0.464	regulation of RNA metabolic process
GO:0009893	0.459	positive regulation of metabolic process
GO:0010556	0.459	regulation of macromolecule biosynthetic process
GO:0010605	0.456	negative regulation of macromolecule metabolic process
GO:0006355	0.454	regulation of DNA-templated transcription
GO:0043170	0.441	macromolecule metabolic process
GO:0051172	0.423	negative regulation of nitrogen compound metabolic process
GO:0010604	0.401	positive regulation of macromolecule metabolic process
GO:0051173	0.399	positive regulation of nitrogen compound metabolic process
GO:1901564	0.337	organonitrogen compound metabolic process
GO:0050896	0.328	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016604	0.999	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]