StarFunc result for job id P43365

User Input

>input (314 residues)
MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETASSSSTLVEVTLREVPAAESPS
PPHSPQGASTLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFL
LLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYILVT
CLGLSYDGLLGDNQIVPKTGLLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFA
HPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHLLKISGGPHIS
YPPLHEWAFREGEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43365	1.000	1.000	2.284E-54	314	1.000	1.000	P43365.pdb.gz	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
2	AFDB:P43356	0.703	0.703	5.200E-45	314	0.882	0.882	P43356.pdb.gz	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
3	AFDB:P43357	0.631	0.631	1.317E-44	314	0.854	0.854	P43357.pdb.gz	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
4	AFDB:P43358	0.670	0.664	4.580E-37	317	0.685	0.678	P43358.pdb.gz	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
5	AFDB:P43355	0.666	0.676	6.019E-35	309	0.662	0.673	P43355.pdb.gz	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
6	AFDB:P43361	0.644	0.636	5.470E-34	318	0.646	0.638	P43361.pdb.gz	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
7	AFDB:P43362	0.650	0.648	1.390E-30	315	0.592	0.590	P43362.pdb.gz	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
8	AFDB:P43364	0.603	0.444	2.344E-30	429	0.596	0.436	P43364.pdb.gz	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
9	AFDB:Q96LZ2	0.419	0.387	4.484E-21	347	0.360	0.326	Q96LZ2.pdb.gz	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
10	AFDB:Q96M61	0.538	0.496	1.203E-20	343	0.341	0.312	Q96M61.pdb.gz	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
11	PDB:7qcdE	0.268	0.318	1.535E-4	261	0.121	0.146	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7tveF	0.270	0.309	9.287E-4	270	0.111	0.130	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
13	PDB:7a6hO	0.188	0.133	1.509E-2	512	0.080	0.049	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
14	PDB:3cuqA	0.191	0.258	2.137E-2	219	0.096	0.137	3cuqA.pdb.gz
15	PDB:7z1mO	0.149	0.102	2.696E-2	570	0.086	0.047	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
16	PDB:1w7pD	0.169	0.276	3.210E-2	171	0.057	0.105	1w7pD.pdb.gz
17	PDB:7d58O	0.205	0.144	4.291E-2	490	0.102	0.065	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
18	PDB:1ldjA	0.163	0.078	7.670E-2	725	0.076	0.033	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
19	PDB:2qbyA	0.208	0.182	1.025E-1	366	0.032	0.027	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
20	PDB:5h3rA	0.202	0.396	1.025E-1	141	0.067	0.149	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43356	0.0	546	314	0.882	0.882	MAGA2_HUMAN Melanoma-associated antigen 2 OS=Homo sapiens OX=9606 GN=MAGEA2 PE=1 SV=1
2	P43357	0.0	548	314	0.854	0.854	MAGA3_HUMAN Melanoma-associated antigen 3 OS=Homo sapiens OX=9606 GN=MAGEA3 PE=1 SV=1
3	P43360	0.0	525	314	0.844	0.844	MAGA6_HUMAN Melanoma-associated antigen 6 OS=Homo sapiens OX=9606 GN=MAGEA6 PE=1 SV=1
4	P43365	0.0	639	314	1.000	1.000	MAGAC_HUMAN Melanoma-associated antigen 12 OS=Homo sapiens OX=9606 GN=MAGEA12 PE=1 SV=2
5	Q96E03	0.0	548	314	0.885	0.885	Q96E03_HUMAN Melanoma antigen family A, 2B OS=Homo sapiens OX=9606 GN=MAGEA2B PE=1 SV=1
6	Q1RN33	6.16e-147	417	317	0.672	0.666	Q1RN33_HUMAN Melanoma antigen A 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=1
7	P43358	8.10e-147	417	317	0.672	0.666	MAGA4_HUMAN Melanoma-associated antigen 4 OS=Homo sapiens OX=9606 GN=MAGEA4 PE=1 SV=2
8	P43361	5.52e-129	372	318	0.650	0.642	MAGA8_HUMAN Melanoma-associated antigen 8 OS=Homo sapiens OX=9606 GN=MAGEA8 PE=1 SV=2
9	P43355	1.42e-128	370	309	0.646	0.657	MAGA1_HUMAN Melanoma-associated antigen 1 OS=Homo sapiens OX=9606 GN=MAGEA1 PE=1 SV=1
10	G5E962	5.09e-121	355	400	0.596	0.468	G5E962_HUMAN MAGE family member A11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=1
11	P43364	1.42e-120	355	429	0.596	0.436	MAGAB_HUMAN Melanoma-associated antigen 11 OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
12	P43362	2.92e-108	319	315	0.599	0.597	MAGA9_HUMAN Melanoma-associated antigen 9 OS=Homo sapiens OX=9606 GN=MAGEA9 PE=1 SV=1
13	P43363	6.46e-98	295	369	0.525	0.447	MAGAA_HUMAN Melanoma-associated antigen 10 OS=Homo sapiens OX=9606 GN=MAGEA10 PE=1 SV=2
14	C9J2X2	5.33e-76	236	295	0.411	0.437	C9J2X2_HUMAN MAGE family member A11 (Fragment) OS=Homo sapiens OX=9606 GN=MAGEA11 PE=1 SV=2
15	O15481	3.14e-66	213	346	0.404	0.367	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
16	Q96M61	2.57e-65	211	343	0.395	0.362	MAGBI_HUMAN Melanoma-associated antigen B18 OS=Homo sapiens OX=9606 GN=MAGEB18 PE=1 SV=2
17	O15480	3.42e-62	202	346	0.369	0.335	MAGB3_HUMAN Melanoma-associated antigen B3 OS=Homo sapiens OX=9606 GN=MAGEB3 PE=1 SV=2
18	Q96LZ2	1.14e-60	199	347	0.334	0.303	MAGBA_HUMAN Melanoma-associated antigen B10 OS=Homo sapiens OX=9606 GN=MAGEB10 PE=1 SV=4
19	Q9UBF1	5.10e-55	185	373	0.318	0.268	MAGC2_HUMAN Melanoma-associated antigen C2 OS=Homo sapiens OX=9606 GN=MAGEC2 PE=1 SV=1
20	Q8BQR7	1.71e-54	182	327	0.325	0.312	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01454 MAGE	3.8e-13	61.2	MAGE homology domain
2	PF12440 MAGE_N	1.1e-22	91.8	Melanoma associated antigen family N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377478

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359310	0.884	Putative chondrosarcoma-associated gene 1 protein
2	9606.ENSP00000473093	0.774	Melanoma-associated antigen 3
3	9606.ENSP00000480637	0.773	Melanoma-associated antigen 6
4	9606.ENSP00000355421	0.746	G antigen 2A
5	9606.ENSP00000332602	0.697	Cancer/testis antigen 1B
6	9606.ENSP00000469441	0.696	Cancer/testis antigen 1A
7	9606.ENSP00000404123	0.694	G antigen 12F
8	9606.ENSP00000341021	0.688	Nanos homolog 2
9	9606.ENSP00000485541	0.679	Melanoma-associated antigen 2
10	9606.ENSP00000478568	0.677	G antigen 2E
11	9606.ENSP00000445675	0.666	Melanoma antigen preferentially expressed in tumors
12	9606.ENSP00000416249	0.652	G antigen 12G
13	9606.ENSP00000402758	0.610	Melanocyte protein PMEL
14	9606.ENSP00000484668	0.605	G antigen 1
15	9606.ENSP00000485185	0.605	Unknown. Candidate gene encoding tumor antigens
16	9606.ENSP00000467141	0.564	Titin
17	9606.ENSP00000333487	0.558	Melanoma antigen family A, 2B
18	9606.ENSP00000349085	0.541	Melanoma-associated antigen 1
19	9606.ENSP00000470185	0.540	Cancer/testis antigen family 45 member A1
20	9606.ENSP00000351884	0.535	Sperm protein associated with the nucleus on the X chromosome C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048519	0.989	negative regulation of biological process
GO:0019222	0.975	regulation of metabolic process
GO:0048523	0.973	negative regulation of cellular process
GO:0031323	0.937	regulation of cellular metabolic process
GO:0080090	0.930	regulation of primary metabolic process
GO:0060255	0.930	regulation of macromolecule metabolic process
GO:0051171	0.929	regulation of nitrogen compound metabolic process
GO:0009892	0.915	negative regulation of metabolic process
GO:0031324	0.910	negative regulation of cellular metabolic process
GO:0010605	0.883	negative regulation of macromolecule metabolic process
GO:0010468	0.882	regulation of gene expression
GO:0051172	0.880	negative regulation of nitrogen compound metabolic process
GO:0010506	0.862	regulation of autophagy
GO:0008152	0.856	metabolic process
GO:0048518	0.825	positive regulation of biological process
GO:0051246	0.816	regulation of protein metabolic process
GO:0051248	0.789	negative regulation of protein metabolic process
GO:0009987	0.768	cellular process
GO:0019219	0.766	regulation of nucleobase-containing compound metabolic process
GO:0048583	0.735	regulation of response to stimulus
GO:0009966	0.712	regulation of signal transduction
GO:0009893	0.699	positive regulation of metabolic process
GO:0050790	0.681	regulation of catalytic activity
GO:0071704	0.674	organic substance metabolic process
GO:0051173	0.595	positive regulation of nitrogen compound metabolic process
GO:0044238	0.577	primary metabolic process
GO:0044237	0.564	cellular metabolic process
GO:0050896	0.542	response to stimulus
GO:0006807	0.538	nitrogen compound metabolic process
GO:0051252	0.494	regulation of RNA metabolic process
GO:0009889	0.485	regulation of biosynthetic process
GO:0048522	0.458	positive regulation of cellular process
GO:1901564	0.395	organonitrogen compound metabolic process
GO:0045934	0.393	negative regulation of nucleobase-containing compound metabolic process
GO:0009968	0.388	negative regulation of signal transduction
GO:0031399	0.361	regulation of protein modification process
GO:0010556	0.352	regulation of macromolecule biosynthetic process
GO:0031326	0.352	regulation of cellular biosynthetic process
GO:0031330	0.352	negative regulation of cellular catabolic process
GO:0010558	0.330	negative regulation of macromolecule biosynthetic process
GO:0031327	0.330	negative regulation of cellular biosynthetic process
GO:0051716	0.327	cellular response to stimulus
GO:0010507	0.326	negative regulation of autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0016020	0.988	membrane
GO:0071944	0.941	cell periphery
GO:0005886	0.896	plasma membrane
GO:0016604	0.704	nuclear body
GO:0012505	0.603	endomembrane system
GO:0005829	0.424	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]