StarFunc result for job id P43378

User Input

>input (593 residues)
MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLR
AIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPH
KSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFP
ARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECLPENLGGYVK
IDLATWNFQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQK
QGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINA
SFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEK
DSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASL
IDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGT
LNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35239	0.905	0.905	0.000	593	0.973	0.973	O35239.pdb.gz	PTN9_MOUSE Tyrosine-protein phosphatase non-receptor type 9 OS=Mus musculus OX=10090 GN=Ptpn9 PE=1 SV=2
2	AFDB:E7F716	0.535	0.555	2.924E-85	571	0.673	0.699	E7F716.pdb.gz	E7F716_DANRE Protein tyrosine phosphatase non-receptor type 9a OS=Danio rerio OX=7955 GN=ptpn9a PE=1 SV=1
3	AFDB:Q9W323	0.525	0.379	1.430E-61	827	0.447	0.320	Q9W323.pdb.gz	Q9W323_DROME LD27988p OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=2
4	AFDB:P18052	0.478	0.346	1.980E-30	829	0.201	0.144	P18052.pdb.gz	PTPRA_MOUSE Receptor-type tyrosine-protein phosphatase alpha OS=Mus musculus OX=10090 GN=Ptpra PE=1 SV=3
5	AFDB:B3DJL5	0.475	0.342	2.721E-30	835	0.196	0.139	B3DJL5.pdb.gz
6	AFDB:A0A0R4I9I3	0.468	0.400	3.546E-30	696	0.199	0.170	A0A0R4I9I3.pdb.gz
7	AFDB:Q13332	0.458	0.143	9.699E-30	1948	0.201	0.061	Q13332.pdb.gz	PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3
8	AFDB:F1NPE8	0.469	0.341	1.023E-29	821	0.202	0.146	F1NPE8.pdb.gz
9	AFDB:P23468	0.463	0.150	1.482E-29	1912	0.204	0.063	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
10	AFDB:F1NWE3	0.458	0.183	2.263E-29	1516	0.206	0.080	F1NWE3.pdb.gz	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
11	PDB:3ps5A	0.452	0.504	1.732E-24	529	0.182	0.204	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
12	PDB:5xzrA	0.455	0.518	3.636E-24	519	0.175	0.200	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
13	PDB:4gwfA	0.459	0.544	5.554E-24	497	0.174	0.207	4gwfA.pdb.gz
14	PDB:6krwA	0.416	0.778	4.391E-21	306	0.162	0.314	6krwA.pdb.gz
15	PDB:3m4uA	0.408	0.814	9.257E-17	285	0.152	0.316	3m4uA.pdb.gz
16	PDB:1oizA	0.356	0.751	3.307E-14	265	0.098	0.219	1oizA.pdb.gz	The Molecular Basis of Vitamin E Retention: Structure of Human Alpha-Tocopherol Transfer Protein
17	PDB:3w68C	0.339	0.747	3.676E-14	252	0.099	0.234	3w68C.pdb.gz	Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
18	PDB:4cizA	0.374	0.754	2.346E-13	284	0.108	0.225	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
19	PDB:6f0eA	0.292	0.518	2.357E-9	300	0.078	0.153	6f0eA.pdb.gz	Target Identification and Mechanism of Action of Picolinamide and Benzamide Chemotypes with Antifungal Properties.
20	PDB:4tlgA	0.291	0.407	9.339E-9	396	0.073	0.109	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F716	0.0	835	571	0.675	0.701	E7F716_DANRE Protein tyrosine phosphatase non-receptor type 9a OS=Danio rerio OX=7955 GN=ptpn9a PE=1 SV=1
2	O35239	0.0	1213	593	0.973	0.973	PTN9_MOUSE Tyrosine-protein phosphatase non-receptor type 9 OS=Mus musculus OX=10090 GN=Ptpn9 PE=1 SV=2
3	P43378	0.0	1243	593	1.000	1.000	PTN9_HUMAN Tyrosine-protein phosphatase non-receptor type 9 OS=Homo sapiens OX=9606 GN=PTPN9 PE=1 SV=1
4	Q641Z2	0.0	1214	593	0.971	0.971	PTN9_RAT Tyrosine-protein phosphatase non-receptor type 9 OS=Rattus norvegicus OX=10116 GN=Ptpn9 PE=2 SV=1
5	Q6IQ43	0.0	1214	583	0.980	0.997	Q6IQ43_HUMAN PTPN9 protein OS=Homo sapiens OX=9606 GN=PTPN9 PE=1 SV=1
6	Q8IRM6	7.11e-102	319	498	0.256	0.305	Q8IRM6_DROME Protein tyrosine phosphatase Meg2, isoform D OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
7	Q59E68	4.56e-101	320	597	0.256	0.255	Q59E68_DROME Protein tyrosine phosphatase Meg2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
8	Q8IRM7	2.33e-99	322	797	0.256	0.191	Q8IRM7_DROME LD30065p OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
9	M9MS42	2.37e-99	321	790	0.256	0.192	M9MS42_DROME Protein tyrosine phosphatase Meg2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
10	Q9W324	3.20e-99	321	802	0.256	0.190	Q9W324_DROME LP18470p OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=2
11	Q9W323	9.00e-99	320	827	0.256	0.184	Q9W323_DROME LD27988p OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=2
12	P18052	4.63e-61	219	829	0.192	0.138	PTPRA_MOUSE Receptor-type tyrosine-protein phosphatase alpha OS=Mus musculus OX=10090 GN=Ptpra PE=1 SV=3
13	P18433	8.01e-61	218	802	0.192	0.142	PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3
14	Q64604	2.90e-59	216	1898	0.196	0.061	PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus OX=10116 GN=Ptprf PE=2 SV=1
15	A2A8L5	3.66e-59	216	1898	0.196	0.061	PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
16	A4IFW2	1.35e-58	214	1909	0.202	0.063	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
17	Q03348	1.40e-58	211	796	0.189	0.141	PTPRA_RAT Receptor-type tyrosine-protein phosphatase alpha OS=Rattus norvegicus OX=10116 GN=Ptpra PE=1 SV=1
18	B0V2N1	1.80e-58	214	1907	0.197	0.061	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
19	Q64605	2.62e-58	214	1907	0.196	0.061	PTPRS_RAT Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus OX=10116 GN=Ptprs PE=1 SV=2
20	F1NWE3	2.99e-58	213	1516	0.231	0.090	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00650 CRAL_TRIO	1.1e-25	101.8	CRAL/TRIO domain
2	PF13716 CRAL_TRIO_2	3.4e-08	45.3	Divergent CRAL/TRIO domain
3	PF00782 DSPc	1.4e+02	13.7	Dual specificity phosphatase, catalytic domain
4	PF14566 PTPlike_phytase	1e+02	14.5	Inositol hexakisphosphate
5	PF00102 Y_phosphatase	9.8e-81	282.3	Protein-tyrosine phosphatase
6	PF13350 Y_phosphatase3	42	15.6	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482732

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263708	0.928	Tyrosine-protein phosphatase non-receptor type 4
2	9606.ENSP00000265562	0.922	Tyrosine-protein phosphatase non-receptor type 23
3	9606.ENSP00000340944	0.922	Tyrosine-protein phosphatase non-receptor type 11
4	9606.ENSP00000394794	0.921	Tyrosine-protein phosphatase non-receptor type 13
5	9606.ENSP00000311857	0.920	Tyrosine-protein phosphatase non-receptor type 2
6	9606.ENSP00000309116	0.918	Tyrosine-protein phosphatase non-receptor type 7
7	9606.ENSP00000248594	0.917	Tyrosine-protein phosphatase non-receptor type 12
8	9606.ENSP00000376268	0.917	SEC14-like protein 1
9	9606.ENSP00000355923	0.915	Tyrosine-protein phosphatase non-receptor type 14
10	9606.ENSP00000351342	0.914	Tyrosine-protein phosphatase non-receptor type 5
11	9606.ENSP00000391592	0.913	Tyrosine-protein phosphatase non-receptor type 6
12	9606.ENSP00000175756	0.912	Tyrosine-protein phosphatase non-receptor type 18
13	9606.ENSP00000363459	0.905	Tyrosine-protein phosphatase non-receptor type 20
14	9606.ENSP00000332973	0.902	Mothers against decapentaplegic homolog 3
15	9606.ENSP00000263326	0.900	Interleukin-37
16	9606.ENSP00000280362	0.749	6-pyruvoyl tetrahydrobiopterin synthase
17	9606.ENSP00000283351	0.684	Trafficking protein particle complex subunit 8
18	9606.ENSP00000452796	0.649	Pseudopodium-enriched atypical kinase 1
19	9606.ENSP00000438399	0.647	IST1 homolog
20	9606.ENSP00000274217	0.642	Inactive ubiquitin thioesterase FAM105A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0004726	0.541	non-membrane spanning protein tyrosine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.973	organic substance metabolic process
GO:0050794	0.972	regulation of cellular process
GO:0044238	0.971	primary metabolic process
GO:0044237	0.970	cellular metabolic process
GO:0006807	0.964	nitrogen compound metabolic process
GO:0043170	0.946	macromolecule metabolic process
GO:0006470	0.926	protein dephosphorylation
GO:0035335	0.911	peptidyl-tyrosine dephosphorylation
GO:0060341	0.858	regulation of cellular localization
GO:0048522	0.847	positive regulation of cellular process
GO:0032880	0.844	regulation of protein localization
GO:1903829	0.779	positive regulation of protein localization
GO:0048523	0.775	negative regulation of cellular process
GO:0051128	0.760	regulation of cellular component organization
GO:1904375	0.720	regulation of protein localization to cell periphery
GO:1905475	0.719	regulation of protein localization to membrane
GO:1904377	0.623	positive regulation of protein localization to cell periphery
GO:0031344	0.546	regulation of cell projection organization
GO:0051129	0.540	negative regulation of cellular component organization
GO:0010977	0.458	negative regulation of neuron projection development
GO:1905477	0.412	positive regulation of protein localization to membrane
GO:0032502	0.344	developmental process
GO:0032501	0.315	multicellular organismal process
GO:0048856	0.303	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.992	cytoplasm
GO:0042995	0.988	cell projection
GO:0044306	0.936	neuron projection terminus
GO:0016020	0.595	membrane
GO:0005829	0.415	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]