StarFunc result for job id P43403

User Input

>input (619 residues)
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
AQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARIT
SPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSL
ASKVEGPPGSTQKAEAACA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43403	1.000	1.000	0.000	619	1.000	1.000	P43403.pdb.gz	ZAP70_HUMAN Tyrosine-protein kinase ZAP-70 OS=Homo sapiens OX=9606 GN=ZAP70 PE=1 SV=1
2	PDB:4k2rA	0.870	0.977	1.253E-86	551	0.874	0.982	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
3	AFDB:M9MM92	0.760	0.777	1.400E-80	604	0.638	0.654	M9MM92.pdb.gz
4	AFDB:P43405	0.640	0.625	6.161E-70	635	0.546	0.532	P43405.pdb.gz	KSYK_HUMAN Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK PE=1 SV=1
5	AFDB:F1N9Y5	0.613	0.619	2.904E-69	613	0.544	0.550	F1N9Y5.pdb.gz	KSYK_CHICK Tyrosine-protein kinase SYK OS=Gallus gallus OX=9031 GN=SYK PE=1 SV=2
6	AFDB:F1QFN4	0.622	0.632	7.145E-69	608	0.530	0.539	F1QFN4.pdb.gz
7	AFDB:Q910A2	0.600	0.631	2.888E-66	586	0.522	0.551	Q910A2.pdb.gz
8	PDB:4fl2A	0.618	0.682	6.946E-66	555	0.527	0.587	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
9	AFDB:Q24145	0.409	0.278	5.211E-34	939	0.309	0.203	Q24145.pdb.gz	SHARK_DROME Tyrosine-protein kinase Shark OS=Drosophila melanogaster OX=7227 GN=Shark PE=1 SV=2
10	AFDB:P42682	0.421	0.491	1.097E-30	527	0.204	0.239	P42682.pdb.gz	TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus OX=10090 GN=Txk PE=1 SV=1
11	AFDB:Q9V9J3	0.423	0.501	4.451E-30	517	0.233	0.279	Q9V9J3.pdb.gz	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
12	AFDB:G5ECJ6	0.388	0.444	4.919E-30	539	0.225	0.258	G5ECJ6.pdb.gz	CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans OX=6239 GN=csk-1 PE=1 SV=1
13	PDB:2h8hA	0.398	0.543	3.199E-26	445	0.221	0.308	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:1k9aB	0.385	0.535	4.764E-25	441	0.220	0.308	1k9aB.pdb.gz
15	PDB:7mfdA	0.372	0.545	4.658E-13	410	0.108	0.163	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
16	PDB:3eqdA	0.373	0.694	6.949E-13	315	0.113	0.222	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
17	PDB:4btfA	0.344	0.499	9.863E-13	413	0.090	0.136	4btfA.pdb.gz
18	PDB:4zhxA	0.361	0.532	9.863E-13	409	0.111	0.169	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:5ufuA	0.344	0.558	9.863E-13	369	0.110	0.184	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:6s73A	0.362	0.795	1.710E-12	269	0.107	0.245	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QFU7	0.0	684	585	0.540	0.571	E9QFU7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=syk PE=3 SV=3
2	F1N9Y5	0.0	704	613	0.557	0.563	KSYK_CHICK Tyrosine-protein kinase SYK OS=Gallus gallus OX=9031 GN=SYK PE=1 SV=2
3	P43403	0.0	1291	619	1.000	1.000	ZAP70_HUMAN Tyrosine-protein kinase ZAP-70 OS=Homo sapiens OX=9606 GN=ZAP70 PE=1 SV=1
4	P43404	0.0	1196	618	0.937	0.939	ZAP70_MOUSE Tyrosine-protein kinase ZAP-70 OS=Mus musculus OX=10090 GN=Zap70 PE=1 SV=3
5	P43405	0.0	696	635	0.553	0.539	KSYK_HUMAN Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK PE=1 SV=1
6	P48025	0.0	681	629	0.549	0.541	KSYK_MOUSE Tyrosine-protein kinase SYK OS=Mus musculus OX=10090 GN=Syk PE=1 SV=2
7	Q00655	0.0	683	628	0.548	0.540	KSYK_PIG Tyrosine-protein kinase SYK OS=Sus scrofa OX=9823 GN=SYK PE=1 SV=1
8	Q503P3	0.0	825	604	0.638	0.654	Q503P3_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:110383 PE=2 SV=1
9	Q64725	0.0	680	629	0.543	0.534	KSYK_RAT Tyrosine-protein kinase SYK OS=Rattus norvegicus OX=10116 GN=Syk PE=1 SV=1
10	P00519	2.60e-66	237	1130	0.246	0.135	ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4
11	E9PT20	3.26e-66	237	1143	0.244	0.132	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
12	Q2PYT4	3.33e-66	237	1143	0.244	0.132	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
13	F7BN18	3.78e-66	236	1128	0.242	0.133	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
14	P00520	5.23e-66	236	1123	0.244	0.134	ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus OX=10090 GN=Abl1 PE=1 SV=3
15	P42684	1.03e-64	233	1182	0.241	0.126	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
16	O45539	4.70e-64	221	507	0.226	0.276	SRC2_CAEEL Tyrosine protein-kinase src-2 OS=Caenorhabditis elegans OX=6239 GN=src-2 PE=1 SV=2
17	P00522	6.24e-64	231	1620	0.234	0.090	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
18	Q2TGI0	1.56e-63	214	310	0.173	0.345	Q2TGI0_DROME Focal adhesion kinase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
19	Q4JIM5	2.15e-63	229	1182	0.237	0.124	ABL2_MOUSE Tyrosine-protein kinase ABL2 OS=Mus musculus OX=10090 GN=Abl2 PE=1 SV=1
20	Q98SN4	3.80e-63	228	1050	0.202	0.119	Q98SN4_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.4	19.6	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	36	14.8	Haspin like kinase domain
3	PF06293 Kdo	69	14.3	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	5.4e-41	152.3	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	8.9e-87	302.2	Protein tyrosine and serine/threonine kinase
6	PF00017 SH2	1.5e-36	135.7	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264972

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000046794	0.999	Lymphocyte cytosolic protein 2
2	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
3	9606.ENSP00000354566	0.999	T-cell surface glycoprotein CD3 epsilon chain
4	9606.ENSP00000354782	0.999	T-cell surface glycoprotein CD3 zeta chain
5	9606.ENSP00000472929	0.999	Proto-oncogene vav
6	9606.ENSP00000401303	0.998	SHC-transforming protein 1
7	9606.ENSP00000378845	0.997	Linker for activation of T cells
8	9606.ENSP00000337825	0.995	Tyrosine-protein kinase Lck
9	9606.ENSP00000300692	0.994	T-cell surface glycoprotein CD3 delta chain
10	9606.ENSP00000011653	0.991	T-cell surface glycoprotein CD4
11	9606.ENSP00000431445	0.991	T-cell surface glycoprotein CD3 gamma chain
12	9606.ENSP00000339186	0.990	GRB2-related adapter protein 2
13	9606.ENSP00000352833	0.988	Tyrosine-protein phosphatase non-receptor type 22
14	9606.ENSP00000264122	0.987	E3 ubiquitin-protein ligase CBL-B
15	9606.ENSP00000324890	0.987	T-cell-specific surface glycoprotein CD28
16	9606.ENSP00000244007	0.981	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
17	9606.ENSP00000262629	0.981	TYRO protein tyrosine kinase-binding protein
18	9606.ENSP00000386559	0.981	T-cell surface glycoprotein CD8 alpha chain
19	9606.ENSP00000422168	0.978	SH3 domain-binding protein 2
20	9606.ENSP00000398655	0.975	Tyrosine-protein kinase ITK/TSK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004713	1.000	protein tyrosine kinase activity
GO:0001784	0.999	phosphotyrosine residue binding
GO:0004715	0.947	non-membrane spanning protein tyrosine kinase activity
GO:0019899	0.586	enzyme binding
GO:0005102	0.502	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.993	positive regulation of cellular process
GO:0051240	0.986	positive regulation of multicellular organismal process
GO:0051094	0.985	positive regulation of developmental process
GO:0060284	0.985	regulation of cell development
GO:0050851	0.985	antigen receptor-mediated signaling pathway
GO:0045785	0.977	positive regulation of cell adhesion
GO:0045621	0.977	positive regulation of lymphocyte differentiation
GO:0045580	0.976	regulation of T cell differentiation
GO:0022407	0.975	regulation of cell-cell adhesion
GO:0050870	0.967	positive regulation of T cell activation
GO:0045582	0.962	positive regulation of T cell differentiation
GO:0018212	0.958	peptidyl-tyrosine modification
GO:0032501	0.954	multicellular organismal process
GO:0001775	0.943	cell activation
GO:0046649	0.928	lymphocyte activation
GO:0018108	0.927	peptidyl-tyrosine phosphorylation
GO:0048856	0.917	anatomical structure development
GO:0042110	0.916	T cell activation
GO:0002521	0.905	leukocyte differentiation
GO:0050852	0.902	T cell receptor signaling pathway
GO:1903131	0.828	mononuclear cell differentiation
GO:0030098	0.813	lymphocyte differentiation
GO:0030217	0.803	T cell differentiation
GO:0045058	0.772	T cell selection
GO:0009966	0.741	regulation of signal transduction
GO:0019222	0.697	regulation of metabolic process
GO:0060255	0.574	regulation of macromolecule metabolic process
GO:0042127	0.566	regulation of cell population proliferation
GO:0009893	0.464	positive regulation of metabolic process
GO:0033077	0.461	T cell differentiation in thymus
GO:0031323	0.421	regulation of cellular metabolic process
GO:0010604	0.419	positive regulation of macromolecule metabolic process
GO:0042221	0.392	response to chemical
GO:0048519	0.389	negative regulation of biological process
GO:0048523	0.370	negative regulation of cellular process
GO:0051171	0.366	regulation of nitrogen compound metabolic process
GO:0010468	0.352	regulation of gene expression
GO:0080090	0.345	regulation of primary metabolic process
GO:0008284	0.343	positive regulation of cell population proliferation
GO:1902531	0.328	regulation of intracellular signal transduction
GO:0046634	0.318	regulation of alpha-beta T cell activation
GO:0031325	0.310	positive regulation of cellular metabolic process
GO:0007275	0.304	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0032991	0.962	protein-containing complex
GO:0043226	0.835	organelle
GO:0043229	0.780	intracellular organelle
GO:0043227	0.765	membrane-bounded organelle
GO:0043231	0.762	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.947	non-specific protein-tyrosine kinase.

[back to server]