StarFunc result for job id P43405

User Input

>input (635 residues)
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43405	1.000	1.000	0.000	635	1.000	1.000	P43405.pdb.gz	KSYK_HUMAN Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK PE=1 SV=1
2	PDB:4fl2A	0.858	0.980	5.369E-93	555	0.871	0.996	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
3	AFDB:F1N9Y5	0.866	0.897	9.596E-89	613	0.776	0.804	F1N9Y5.pdb.gz	KSYK_CHICK Tyrosine-protein kinase SYK OS=Gallus gallus OX=9031 GN=SYK PE=1 SV=2
4	AFDB:F1QFN4	0.846	0.883	1.710E-83	608	0.680	0.711	F1QFN4.pdb.gz
5	AFDB:Q910A2	0.832	0.900	3.949E-77	586	0.639	0.693	Q910A2.pdb.gz
6	AFDB:P43403	0.649	0.664	9.597E-71	619	0.535	0.549	P43403.pdb.gz	ZAP70_HUMAN Tyrosine-protein kinase ZAP-70 OS=Homo sapiens OX=9606 GN=ZAP70 PE=1 SV=1
7	AFDB:M9MM92	0.574	0.601	1.539E-66	604	0.520	0.546	M9MM92.pdb.gz
8	PDB:4k2rA	0.595	0.678	1.085E-61	551	0.498	0.574	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
9	AFDB:Q24145	0.386	0.267	4.451E-35	939	0.306	0.207	Q24145.pdb.gz	SHARK_DROME Tyrosine-protein kinase Shark OS=Drosophila melanogaster OX=7227 GN=Shark PE=1 SV=2
10	AFDB:O45539	0.394	0.489	2.847E-30	507	0.235	0.294	O45539.pdb.gz	SRC2_CAEEL Tyrosine protein-kinase src-2 OS=Caenorhabditis elegans OX=6239 GN=src-2 PE=1 SV=2
11	AFDB:Q9V9J3	0.396	0.483	3.005E-29	517	0.233	0.286	Q9V9J3.pdb.gz	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
12	AFDB:P42685	0.396	0.492	3.163E-29	505	0.225	0.283	P42685.pdb.gz	FRK_HUMAN Tyrosine-protein kinase FRK OS=Homo sapiens OX=9606 GN=FRK PE=1 SV=1
13	PDB:2h8hA	0.381	0.538	8.398E-26	445	0.220	0.315	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:1k9aB	0.363	0.518	1.142E-25	441	0.257	0.370	1k9aB.pdb.gz
15	PDB:4btfA	0.358	0.533	3.292E-13	413	0.096	0.148	4btfA.pdb.gz
16	PDB:6lk5A	0.350	0.791	1.070E-12	265	0.096	0.230	6lk5A.pdb.gz
17	PDB:6s73A	0.367	0.831	2.082E-12	269	0.090	0.212	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:7mfdA	0.339	0.511	2.556E-12	410	0.115	0.178	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
19	PDB:4rerA	0.339	0.460	6.427E-12	459	0.106	0.146	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:5ufuA	0.337	0.562	1.616E-11	369	0.104	0.179	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QFU7	0.0	863	585	0.666	0.723	E9QFU7_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=syk PE=3 SV=3
2	F1N9Y5	0.0	1019	613	0.775	0.803	KSYK_CHICK Tyrosine-protein kinase SYK OS=Gallus gallus OX=9031 GN=SYK PE=1 SV=2
3	P43403	0.0	699	619	0.539	0.553	ZAP70_HUMAN Tyrosine-protein kinase ZAP-70 OS=Homo sapiens OX=9606 GN=ZAP70 PE=1 SV=1
4	P43404	0.0	708	618	0.546	0.561	ZAP70_MOUSE Tyrosine-protein kinase ZAP-70 OS=Mus musculus OX=10090 GN=Zap70 PE=1 SV=3
5	P43405	0.0	1330	635	1.000	1.000	KSYK_HUMAN Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK PE=1 SV=1
6	P48025	0.0	1198	629	0.921	0.930	KSYK_MOUSE Tyrosine-protein kinase SYK OS=Mus musculus OX=10090 GN=Syk PE=1 SV=2
7	Q00655	0.0	1192	628	0.924	0.935	KSYK_PIG Tyrosine-protein kinase SYK OS=Sus scrofa OX=9823 GN=SYK PE=1 SV=1
8	Q503P3	0.0	668	604	0.518	0.545	Q503P3_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:110383 PE=2 SV=1
9	Q64725	0.0	1160	629	0.907	0.916	KSYK_RAT Tyrosine-protein kinase SYK OS=Rattus norvegicus OX=10116 GN=Syk PE=1 SV=1
10	Q2TGI0	4.67e-63	213	310	0.175	0.358	Q2TGI0_DROME Focal adhesion kinase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
11	O45539	8.96e-62	215	507	0.183	0.229	SRC2_CAEEL Tyrosine protein-kinase src-2 OS=Caenorhabditis elegans OX=6239 GN=src-2 PE=1 SV=2
12	A0A2R8RR02	6.38e-61	222	1101	0.184	0.106	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
13	I6L996	7.20e-61	217	680	0.167	0.156	I6L996_HUMAN PTK2 protein OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
14	H0YB16	1.29e-60	217	724	0.167	0.146	H0YB16_HUMAN Protein tyrosine kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
15	Q9U472	1.11e-59	218	1200	0.195	0.103	Q9U472_DROME Focal adhesion kinase homolog FAK56 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
16	Q9U531	1.13e-59	218	1200	0.195	0.103	Q9U531_DROME Focal adhesion kinase homolog DFak56 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
17	E1JGM8	1.24e-59	218	1198	0.195	0.104	E1JGM8_DROME Focal adhesion kinase, isoform F OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
18	Q0E917	1.28e-59	218	1200	0.195	0.103	Q0E917_DROME FI18818p1 OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1
19	B7YZL9	1.32e-59	218	1500	0.195	0.083	B7YZL9_DROME Focal adhesion kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
20	Q9U5Y2	1.48e-59	218	1198	0.195	0.104	Q9U5Y2_DROME Focal adhesion kinase OS=Drosophila melanogaster OX=7227 GN=Fak PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	7.1	17.2	ABC1 atypical kinase-like domain
2	PF06293 Kdo	2.1	19.3	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF00069 Pkinase	4.5e-45	165.7	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	5e-86	299.8	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	2.1e-39	144.8	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364907

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221972	0.999	B-cell antigen receptor complex-associated protein alpha chain
2	9606.ENSP00000224337	0.999	B-cell linker protein
3	9606.ENSP00000262629	0.999	TYRO protein tyrosine kinase-binding protein
4	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
5	9606.ENSP00000289902	0.999	High affinity immunoglobulin epsilon receptor subunit gamma
6	9606.ENSP00000472929	0.999	Proto-oncogene vav
7	9606.ENSP00000271450	0.998	Low affinity immunoglobulin gamma Fc region receptor II-a
8	9606.ENSP00000302569	0.997	C-type lectin domain family 7 member A
9	9606.ENSP00000354566	0.997	T-cell surface glycoprotein CD3 epsilon chain
10	9606.ENSP00000360797	0.997	Caspase recruitment domain-containing protein 9
11	9606.ENSP00000376345	0.997	Growth factor receptor-bound protein 2
12	9606.ENSP00000046794	0.996	Lymphocyte cytosolic protein 2
13	9606.ENSP00000244007	0.996	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
14	9606.ENSP00000391592	0.996	Tyrosine-protein phosphatase non-receptor type 6
15	9606.ENSP00000376544	0.995	B-cell antigen receptor complex-associated protein beta chain
16	9606.ENSP00000363089	0.994	Toll-like receptor 4
17	9606.ENSP00000452786	0.993	Integrin beta-3
18	9606.ENSP00000298527	0.991	C-type lectin domain family 1 member B
19	9606.ENSP00000085219	0.989	B-cell receptor CD22
20	9606.ENSP00000378845	0.988	Linker for activation of T cells

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004715	0.998	non-membrane spanning protein tyrosine kinase activity
GO:0005102	0.830	signaling receptor binding
GO:0019899	0.822	enzyme binding
GO:0051219	0.811	phosphoprotein binding
GO:0050839	0.385	cell adhesion molecule binding
GO:0005126	0.352	cytokine receptor binding
GO:0043274	0.329	phospholipase binding
GO:0005178	0.318	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0051716	0.993	cellular response to stimulus
GO:0007154	0.990	cell communication
GO:0023052	0.989	signaling
GO:0006793	0.987	phosphorus metabolic process
GO:0050778	0.987	positive regulation of immune response
GO:0002696	0.986	positive regulation of leukocyte activation
GO:0002376	0.985	immune system process
GO:0043170	0.985	macromolecule metabolic process
GO:0007165	0.980	signal transduction
GO:0006468	0.975	protein phosphorylation
GO:0019222	0.971	regulation of metabolic process
GO:0018212	0.970	peptidyl-tyrosine modification
GO:0002768	0.964	immune response-regulating cell surface receptor signaling pathway
GO:0018108	0.959	peptidyl-tyrosine phosphorylation
GO:0002757	0.957	immune response-activating signaling pathway
GO:0002429	0.947	immune response-activating cell surface receptor signaling pathway
GO:0051251	0.945	positive regulation of lymphocyte activation
GO:0051050	0.937	positive regulation of transport
GO:0001775	0.935	cell activation
GO:0002697	0.934	regulation of immune effector process
GO:0050851	0.920	antigen receptor-mediated signaling pathway
GO:0002703	0.914	regulation of leukocyte mediated immunity
GO:0002699	0.914	positive regulation of immune effector process
GO:0048856	0.913	anatomical structure development
GO:0046777	0.890	protein autophosphorylation
GO:0023051	0.888	regulation of signaling
GO:1902105	0.879	regulation of leukocyte differentiation
GO:0017157	0.878	regulation of exocytosis
GO:0033006	0.877	regulation of mast cell activation involved in immune response
GO:0002886	0.872	regulation of myeloid leukocyte mediated immunity
GO:0043300	0.872	regulation of leukocyte degranulation
GO:0010646	0.866	regulation of cell communication
GO:0043304	0.850	regulation of mast cell degranulation
GO:1902107	0.846	positive regulation of leukocyte differentiation
GO:0051179	0.843	localization
GO:0045921	0.841	positive regulation of exocytosis
GO:1903307	0.831	positive regulation of regulated secretory pathway
GO:0060255	0.805	regulation of macromolecule metabolic process
GO:0042221	0.795	response to chemical
GO:0006955	0.787	immune response
GO:0009893	0.782	positive regulation of metabolic process
GO:0048519	0.778	negative regulation of biological process
GO:0080090	0.772	regulation of primary metabolic process
GO:0031323	0.763	regulation of cellular metabolic process
GO:0010468	0.759	regulation of gene expression
GO:0051171	0.756	regulation of nitrogen compound metabolic process
GO:0080134	0.754	regulation of response to stress
GO:0006950	0.753	response to stress
GO:0001817	0.742	regulation of cytokine production
GO:0031349	0.742	positive regulation of defense response
GO:0051247	0.742	positive regulation of protein metabolic process
GO:0009967	0.738	positive regulation of signal transduction
GO:0071310	0.737	cellular response to organic substance
GO:0043302	0.737	positive regulation of leukocyte degranulation
GO:0044093	0.733	positive regulation of molecular function
GO:0032103	0.726	positive regulation of response to external stimulus
GO:0042127	0.724	regulation of cell population proliferation
GO:0045088	0.713	regulation of innate immune response
GO:0035556	0.690	intracellular signal transduction
GO:0048468	0.687	cell development
GO:0031325	0.677	positive regulation of cellular metabolic process
GO:0010628	0.673	positive regulation of gene expression
GO:0050790	0.663	regulation of catalytic activity
GO:0002252	0.630	immune effector process
GO:0002833	0.590	positive regulation of response to biotic stimulus
GO:0051234	0.589	establishment of localization
GO:0006810	0.554	transport
GO:0045619	0.540	regulation of lymphocyte differentiation
GO:0045621	0.531	positive regulation of lymphocyte differentiation
GO:1902531	0.494	regulation of intracellular signal transduction
GO:0048523	0.465	negative regulation of cellular process
GO:0051641	0.460	cellular localization
GO:1902533	0.457	positive regulation of intracellular signal transduction
GO:0050853	0.451	B cell receptor signaling pathway
GO:0019220	0.447	regulation of phosphate metabolic process
GO:0007275	0.443	multicellular organism development
GO:0048731	0.333	system development
GO:0009605	0.328	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0016020	0.996	membrane
GO:0071944	0.989	cell periphery
GO:0005886	0.977	plasma membrane
GO:0043226	0.812	organelle
GO:0043227	0.751	membrane-bounded organelle
GO:0043229	0.726	intracellular organelle
GO:0043231	0.704	intracellular membrane-bounded organelle
GO:0005634	0.368	nucleus
GO:0032991	0.327	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.2	0.998	non-specific protein-tyrosine kinase.

[back to server]