StarFunc result for job id P43489

User Input

>input (277 residues)
MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQ
NTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYK
PGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQ
GPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL
RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43489	1.000	1.000	9.119E-49	277	1.000	1.000	P43489.pdb.gz	TNR4_HUMAN Tumor necrosis factor receptor superfamily member 4 OS=Homo sapiens OX=9606 GN=TNFRSF4 PE=1 SV=1
2	AFDB:P47741	0.568	0.577	4.874E-30	272	0.592	0.603	P47741.pdb.gz	TNR4_MOUSE Tumor necrosis factor receptor superfamily member 4 OS=Mus musculus OX=10090 GN=Tnfrsf4 PE=1 SV=1
3	AFDB:F1RAS9	0.269	0.179	2.068E-11	425	0.224	0.146	F1RAS9.pdb.gz	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
4	AFDB:O75509	0.235	0.109	1.652E-10	655	0.188	0.079	O75509.pdb.gz	TNR21_HUMAN Tumor necrosis factor receptor superfamily member 21 OS=Homo sapiens OX=9606 GN=TNFRSF21 PE=1 SV=1
5	AFDB:P20333	0.287	0.193	6.233E-10	461	0.238	0.143	P20333.pdb.gz	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
6	AFDB:Q80WY6	0.273	0.167	1.320E-9	474	0.231	0.135	Q80WY6.pdb.gz	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
7	AFDB:D3ZF92	0.233	0.106	1.570E-9	655	0.177	0.075	D3ZF92.pdb.gz	TNR21_RAT Tumor necrosis factor receptor superfamily member 21 OS=Rattus norvegicus OX=10116 GN=Tnfrsf21 PE=1 SV=1
8	AFDB:P25119	0.274	0.166	8.871E-9	474	0.245	0.143	P25119.pdb.gz	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1
9	AFDB:Q3U4N7	0.147	0.125	2.207E-1	345	0.159	0.128	Q3U4N7.pdb.gz	IGFR1_MOUSE IGF-like family receptor 1 OS=Mus musculus OX=10090 GN=Igflr1 PE=1 SV=1
10	AFDB:E1JIZ9	0.069	0.038	1.247	651	0.199	0.084	E1JIZ9.pdb.gz	E1JIZ9_DROME Trivet, isoform I OS=Drosophila melanogaster OX=7227 GN=trv PE=4 SV=2
11	PDB:7dtvA	0.152	0.061	1.615	779	0.040	0.014	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
12	PDB:7wihA	0.103	0.047	2.563	741	0.051	0.019	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
13	PDB:7epaA	0.121	0.051	3.840	782	0.040	0.014	7epaA.pdb.gz
14	PDB:7abzX	0.061	0.131	4.310	77	0.036	0.130	7abzX.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
15	PDB:3hksA	0.078	0.119	5.429	144	0.061	0.118	3hksA.pdb.gz
16	PDB:7e9gR	0.125	0.053	6.094	769	0.047	0.017	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
17	PDB:4rqtA	0.070	0.058	6.840	375	0.036	0.027	4rqtA.pdb.gz	Structural insight into the conformational change of alcohol dehydrogenase from arabidopsis Thalianal during coenzyme binding.
18	PDB:6xywAx	0.057	0.121	6.840	99	0.018	0.051	6xywAx.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
19	PDB:3j6bS	0.055	0.088	8.133	146	0.022	0.041	3j6bS.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
20	PDB:6nuaB	0.076	0.087	8.616	227	0.036	0.044	6nuaB.pdb.gz	Protection of abasic sites during DNA replication by a stable thiazolidine protein-DNA cross-link.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43489	0.0	558	277	1.000	1.000	TNR4_HUMAN Tumor necrosis factor receptor superfamily member 4 OS=Homo sapiens OX=9606 GN=TNFRSF4 PE=1 SV=1
2	P15725	2.10e-92	276	271	0.599	0.613	TNR4_RAT Tumor necrosis factor receptor superfamily member 4 OS=Rattus norvegicus OX=10116 GN=Tnfrsf4 PE=2 SV=1
3	P47741	2.59e-87	263	272	0.581	0.592	TNR4_MOUSE Tumor necrosis factor receptor superfamily member 4 OS=Mus musculus OX=10090 GN=Tnfrsf4 PE=1 SV=1
4	Q9Y6Q6	1.79e-13	72.4	616	0.206	0.093	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
5	A0A8I6A4J5	7.98e-13	68.9	260	0.166	0.177	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
6	P50284	1.16e-12	69.7	415	0.184	0.123	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
7	A0A8I6AHI1	1.69e-12	68.6	309	0.162	0.146	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
8	F6SVZ3	2.51e-12	67.4	269	0.159	0.164	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
9	P25942	2.82e-11	64.7	277	0.170	0.170	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
10	Q80WM9	6.61e-11	63.5	275	0.199	0.200	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
11	Q71F55	6.67e-11	63.5	276	0.199	0.199	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
12	O35305	1.90e-10	63.2	625	0.199	0.088	TNR11_MOUSE Tumor necrosis factor receptor superfamily member 11A OS=Mus musculus OX=10090 GN=Tnfrsf11a PE=1 SV=1
13	P27512	1.12e-09	60.1	289	0.152	0.145	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
14	F1RAS9	1.89e-09	60.1	425	0.159	0.104	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
15	F1M8Z6	2.70e-09	59.7	633	0.177	0.077	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2
16	A0A8I5XVD8	3.77e-09	57.4	204	0.148	0.201	A0A8I5XVD8_RAT CD40 molecule OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
17	O95407	5.53e-09	58.2	300	0.181	0.167	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
18	P36941	4.80e-08	55.8	435	0.162	0.103	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
19	P18519	5.16e-08	55.8	416	0.166	0.111	TNR16_CHICK Tumor necrosis factor receptor superfamily member 16 OS=Gallus gallus OX=9031 GN=NGFR PE=2 SV=1
20	P08138	1.58e-07	54.3	427	0.242	0.157	TNR16_HUMAN Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00020 TNFR_c6	2.2e-15	68.1	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368538

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281834	0.999	Tumor necrosis factor ligand superfamily member 4
2	9606.ENSP00000386884	0.957	C-X-C chemokine receptor type 4
3	9606.ENSP00000419945	0.932	Syncytin-1
4	9606.ENSP00000324890	0.916	T-cell-specific surface glycoprotein CD28
5	9606.ENSP00000247668	0.904	TNF receptor-associated factor 2
6	9606.ENSP00000303939	0.904	Cytotoxic T-lymphocyte protein 4
7	9606.ENSP00000256637	0.897	Sortilin
8	9606.ENSP00000328207	0.892	Tumor necrosis factor receptor superfamily member 18
9	9606.ENSP00000454207	0.856	TNF receptor-associated factor 3
10	9606.ENSP00000261464	0.851	TNF receptor-associated factor 5
11	9606.ENSP00000354782	0.847	T-cell surface glycoprotein CD3 zeta chain
12	9606.ENSP00000264246	0.844	T-lymphocyte activation antigen CD80
13	9606.ENSP00000162749	0.842	Tumor necrosis factor receptor superfamily member 1A
14	9606.ENSP00000011653	0.829	T-cell surface glycoprotein CD4
15	9606.ENSP00000332049	0.812	T-lymphocyte activation antigen CD86
16	9606.ENSP00000433623	0.797	TNF receptor-associated factor 6
17	9606.ENSP00000266557	0.794	CD27 antigen
18	9606.ENSP00000386559	0.769	T-cell surface glycoprotein CD8 alpha chain
19	9606.ENSP00000203629	0.765	Lymphocyte activation gene 3 protein
20	9606.ENSP00000398698	0.762	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005035	1.000	death receptor activity
GO:0005031	0.812	tumor necrosis factor receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0002376	0.949	immune system process
GO:0006955	0.927	immune response
GO:0009987	0.845	cellular process
GO:0050789	0.828	regulation of biological process
GO:0050794	0.822	regulation of cellular process
GO:0048518	0.756	positive regulation of biological process
GO:0051716	0.706	cellular response to stimulus
GO:0048522	0.684	positive regulation of cellular process
GO:0019222	0.658	regulation of metabolic process
GO:0060255	0.635	regulation of macromolecule metabolic process
GO:0007154	0.630	cell communication
GO:0023052	0.613	signaling
GO:0007165	0.582	signal transduction
GO:0048519	0.457	negative regulation of biological process
GO:0009893	0.411	positive regulation of metabolic process
GO:0010468	0.407	regulation of gene expression
GO:0010604	0.384	positive regulation of macromolecule metabolic process
GO:0051239	0.379	regulation of multicellular organismal process
GO:0048583	0.369	regulation of response to stimulus
GO:0048523	0.368	negative regulation of cellular process
GO:0080090	0.335	regulation of primary metabolic process
GO:0051171	0.334	regulation of nitrogen compound metabolic process
GO:0002682	0.332	regulation of immune system process
GO:0042221	0.324	response to chemical
GO:0002684	0.314	positive regulation of immune system process
GO:0031323	0.312	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.862	organelle
GO:0043227	0.788	membrane-bounded organelle
GO:0005737	0.703	cytoplasm
GO:0043229	0.525	intracellular organelle
GO:0043231	0.438	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]