StarFunc result for job id P43628

User Input

>input (341 residues)
MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE
VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43626	0.723	0.711	9.764E-56	348	0.921	0.902	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
2	AFDB:P43632	0.677	0.753	6.355E-52	304	0.786	0.882	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
3	AFDB:Q14952	0.676	0.755	3.231E-51	304	0.795	0.891	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
4	AFDB:P43629	0.615	0.490	5.127E-50	444	0.798	0.613	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
5	AFDB:P43630	0.584	0.440	1.189E-48	455	0.848	0.635	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
6	AFDB:Q8N743	0.566	0.472	3.087E-43	410	0.692	0.576	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
7	AFDB:Q99706	0.550	0.500	5.627E-39	377	0.628	0.568	Q99706.pdb.gz	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
8	AFDB:O75022	0.543	0.303	2.263E-29	631	0.375	0.203	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:Q8N423	0.551	0.323	1.032E-28	598	0.390	0.222	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
10	AFDB:Q8NHL6	0.543	0.292	1.090E-28	650	0.370	0.194	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
11	PDB:5c6wJ	0.241	0.313	1.556E-7	238	0.091	0.130	5c6wJ.pdb.gz
12	PDB:3bn9F	0.272	0.362	7.300E-6	224	0.094	0.143	3bn9F.pdb.gz
13	PDB:1ngwH	0.252	0.342	1.937E-5	216	0.088	0.139	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
14	PDB:6vpyL	0.258	0.356	2.830E-5	209	0.067	0.110	6vpyL.pdb.gz
15	PDB:7cztH	0.258	0.370	2.830E-5	221	0.094	0.145	7cztH.pdb.gz
16	PDB:1ct8A	0.231	0.340	3.154E-5	214	0.076	0.121	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
17	PDB:1aqkL	0.235	0.338	3.515E-5	216	0.073	0.116	1aqkL.pdb.gz
18	PDB:6jxrm	0.212	0.279	4.136E-5	248	0.123	0.169	6jxrm.pdb.gz
19	PDB:1cf8L	0.236	0.345	4.367E-5	215	0.067	0.107	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
20	PDB:1fdlL	0.244	0.353	4.610E-5	214	0.076	0.121	1fdlL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43626	0.0	626	348	0.915	0.897	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
2	P43627	0.0	648	348	0.947	0.928	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
3	P43628	0.0	709	341	1.000	1.000	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
4	P43629	0.0	535	444	0.798	0.613	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
5	P43630	0.0	523	455	0.792	0.593	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
6	P43631	0.0	607	304	0.853	0.957	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
7	P43632	0.0	556	304	0.786	0.882	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
8	Q14952	0.0	557	304	0.795	0.891	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
9	Q14953	0.0	562	304	0.801	0.898	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
10	Q14954	0.0	571	304	0.809	0.908	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
11	F2VZG2	8.13e-179	498	293	0.727	0.846	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
12	Q8N743	3.22e-168	476	410	0.692	0.576	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
13	Q14943	4.71e-148	424	382	0.610	0.545	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
14	Q99706	1.92e-146	419	377	0.636	0.576	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
15	Q8N423	1.69e-48	173	597	0.384	0.219	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
16	O75022	7.03e-47	169	631	0.375	0.203	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
17	Q8NHL6	1.50e-46	169	650	0.302	0.158	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
18	O75023	9.80e-46	166	590	0.381	0.220	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
19	O75019	7.94e-43	156	489	0.276	0.192	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
20	Q8N149	2.26e-42	155	483	0.279	0.197	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	2.9e-17	74.0	Immunoglobulin domain
2	PF13895 Ig_2	0.032	25.8	Immunoglobulin domain
3	PF13927 Ig_3	0.00033	32.5	Immunoglobulin domain
4	PF16680 Ig_4	81	15.2	T-cell surface glycoprotein CD3 delta chain
5	PF13908 Shisa	3.5e+02	12.7	Wnt and FGF inhibitory regulator
6	PF07686 V-set	4.4e+02	12.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365402	0.999	HLA class I histocompatibility antigen, Cw-7 alpha chain
2	9606.ENSP00000379873	0.983	HLA class I histocompatibility antigen, A-3 alpha chain
3	9606.ENSP00000371333	0.972	Natural killer cells antigen CD94
4	9606.ENSP00000438038	0.971	NKG2-A/NKG2-B type II integral membrane protein
5	9606.ENSP00000391592	0.962	Tyrosine-protein phosphatase non-receptor type 6
6	9606.ENSP00000371327	0.960	NKG2-C type II integral membrane protein
7	9606.ENSP00000399168	0.957	HLA class I histocompatibility antigen, B-7 alpha chain
8	9606.ENSP00000452780	0.953	Beta-2-microglobulin
9	9606.ENSP00000325525	0.921	Killer cell immunoglobulin-like receptor 3DL2
10	9606.ENSP00000340944	0.914	Tyrosine-protein phosphatase non-receptor type 11
11	9606.ENSP00000336769	0.904	Killer cell immunoglobulin-like receptor 2DL1
12	9606.ENSP00000375608	0.891	Killer cell immunoglobulin-like receptor 3DL1
13	9606.ENSP00000262629	0.885	TYRO protein tyrosine kinase-binding protein
14	9606.ENSP00000365817	0.884	HLA class I histocompatibility antigen, alpha chain E
15	9606.ENSP00000310216	0.870	NKG2-F type II integral membrane protein
16	9606.ENSP00000437563	0.858	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
17	9606.ENSP00000412927	0.837	HLA class I histocompatibility antigen, alpha chain G
18	9606.ENSP00000480609	0.825	annotation not available
19	9606.ENSP00000240618	0.822	Killer cell lectin-like receptor subfamily K, member 1
20	9606.ENSP00000291860	0.809	Killer cell immunoglobulin-like receptor 3DL3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.954	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0002376	0.986	immune system process
GO:0006955	0.914	immune response
GO:0007165	0.897	signal transduction
GO:0007166	0.815	cell surface receptor signaling pathway
GO:0048518	0.813	positive regulation of biological process
GO:0002682	0.806	regulation of immune system process
GO:0048583	0.798	regulation of response to stimulus
GO:0006952	0.679	defense response
GO:0050776	0.646	regulation of immune response
GO:0002764	0.526	immune response-regulating signaling pathway
GO:0050778	0.459	positive regulation of immune response
GO:0048522	0.434	positive regulation of cellular process
GO:0002768	0.419	immune response-regulating cell surface receptor signaling pathway
GO:0048519	0.404	negative regulation of biological process
GO:0080134	0.372	regulation of response to stress
GO:0032501	0.369	multicellular organismal process
GO:0048523	0.357	negative regulation of cellular process
GO:0051239	0.344	regulation of multicellular organismal process
GO:0032101	0.334	regulation of response to external stimulus
GO:0019222	0.321	regulation of metabolic process
GO:0045088	0.317	regulation of innate immune response
GO:0060255	0.313	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]