StarFunc result for job id P43630

User Input

>input (455 residues)
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFML
YKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGN
HRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANF
SIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRAL
PCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLL
YRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKT
PLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43630	1.000	1.000	4.225E-86	455	1.000	1.000	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
2	AFDB:P43629	0.668	0.684	5.672E-71	444	0.835	0.856	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
3	AFDB:Q8N743	0.623	0.689	4.386E-60	410	0.708	0.785	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
4	AFDB:P43626	0.439	0.572	2.175E-47	348	0.644	0.842	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
5	AFDB:P43632	0.441	0.655	8.036E-44	304	0.554	0.829	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
6	AFDB:Q14952	0.439	0.652	2.891E-43	304	0.543	0.812	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
7	AFDB:Q99706	0.229	0.276	6.787E-43	377	0.560	0.676	Q99706.pdb.gz	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
8	AFDB:O75022	0.563	0.416	5.534E-38	631	0.393	0.284	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:Q8N423	0.545	0.425	1.299E-37	598	0.369	0.281	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
10	AFDB:Q8NHL6	0.571	0.413	4.930E-37	650	0.387	0.271	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
11	PDB:5mj3A	0.236	0.327	1.264E-7	302	0.079	0.119	5mj3A.pdb.gz
12	PDB:5oj2B	0.180	0.128	2.043E-7	692	0.092	0.061	5oj2B.pdb.gz
13	PDB:7q5zA	0.180	0.074	3.673E-7	1344	0.088	0.030	7q5zA.pdb.gz
14	PDB:1e07A	0.182	0.141	4.796E-7	642	0.123	0.087	1e07A.pdb.gz
15	PDB:6pxvA	0.162	0.100	5.629E-7	823	0.095	0.052	6pxvA.pdb.gz
16	PDB:5a42A	0.180	0.065	7.752E-7	1597	0.092	0.026	5a42A.pdb.gz
17	PDB:7q1yA	0.170	0.070	2.507E-6	1374	0.092	0.031	7q1yA.pdb.gz
18	PDB:5c6wJ	0.180	0.291	4.507E-6	238	0.053	0.101	5c6wJ.pdb.gz
19	PDB:1ngwH	0.198	0.312	7.684E-6	216	0.070	0.148	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
20	PDB:7sqcO0	0.124	0.062	1.177E-5	1140	0.105	0.042	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43626	0.0	524	348	0.591	0.773	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
2	P43627	0.0	520	348	0.589	0.770	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
3	P43628	0.0	523	341	0.593	0.792	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
4	P43629	0.0	754	444	0.835	0.856	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
5	P43630	0.0	939	455	1.000	1.000	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
6	Q14943	0.0	630	382	0.684	0.814	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
7	Q8N743	0.0	646	410	0.708	0.785	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
8	P43631	7.00e-169	478	304	0.519	0.776	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
9	P43632	4.90e-168	476	304	0.514	0.770	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
10	Q14954	3.40e-163	464	304	0.505	0.757	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
11	Q14952	1.63e-161	459	304	0.501	0.750	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
12	Q14953	2.81e-161	459	304	0.503	0.753	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
13	F2VZG2	4.17e-144	415	293	0.466	0.724	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
14	Q99706	1.19e-139	407	377	0.462	0.557	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
15	O75022	8.21e-78	256	631	0.398	0.287	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
16	Q8N423	1.15e-70	236	597	0.391	0.298	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
17	P59901	1.56e-65	220	499	0.297	0.271	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
18	Q8NHL6	6.07e-64	219	650	0.385	0.269	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
19	O75023	1.34e-61	212	590	0.356	0.275	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
20	O75019	1.54e-61	209	489	0.295	0.274	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	9.3e-26	101.2	Immunoglobulin domain
2	PF13895 Ig_2	7.5e-12	56.7	Immunoglobulin domain
3	PF13927 Ig_3	1.8e-10	52.5	Immunoglobulin domain
4	PF15807 MAP17	1e+02	14.4	Membrane-associated protein 117 kDa, PDZK1-interacting protein 1
5	PF07686 V-set	0.0052	28.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325525

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259951	0.998	HLA class I histocompatibility antigen, alpha chain F
2	9606.ENSP00000379873	0.995	HLA class I histocompatibility antigen, A-3 alpha chain
3	9606.ENSP00000399168	0.992	HLA class I histocompatibility antigen, B-7 alpha chain
4	9606.ENSP00000365402	0.978	HLA class I histocompatibility antigen, Cw-7 alpha chain
5	9606.ENSP00000375608	0.950	Killer cell immunoglobulin-like receptor 3DL1
6	9606.ENSP00000438038	0.950	NKG2-A/NKG2-B type II integral membrane protein
7	9606.ENSP00000371333	0.949	Natural killer cells antigen CD94
8	9606.ENSP00000371327	0.933	NKG2-C type II integral membrane protein
9	9606.ENSP00000412927	0.929	HLA class I histocompatibility antigen, alpha chain G
10	9606.ENSP00000342215	0.921	Killer cell immunoglobulin-like receptor 2DL3
11	9606.ENSP00000452780	0.911	Beta-2-microglobulin
12	9606.ENSP00000365817	0.865	HLA class I histocompatibility antigen, alpha chain E
13	9606.ENSP00000336769	0.861	Killer cell immunoglobulin-like receptor 2DL1
14	9606.ENSP00000340944	0.850	Tyrosine-protein phosphatase non-receptor type 11
15	9606.ENSP00000310216	0.848	NKG2-F type II integral membrane protein
16	9606.ENSP00000437563	0.845	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
17	9606.ENSP00000391592	0.839	Tyrosine-protein phosphatase non-receptor type 6
18	9606.ENSP00000291860	0.809	Killer cell immunoglobulin-like receptor 3DL3
19	9606.ENSP00000262629	0.744	TYRO protein tyrosine kinase-binding protein
20	9606.ENSP00000256649	0.734	Tripartite motif-containing protein 45

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.698	signaling receptor binding
GO:0038023	0.601	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0006952	0.897	defense response
GO:0002376	0.880	immune system process
GO:0051716	0.844	cellular response to stimulus
GO:0023052	0.761	signaling
GO:0007154	0.761	cell communication
GO:0048519	0.746	negative regulation of biological process
GO:0007165	0.737	signal transduction
GO:0048518	0.639	positive regulation of biological process
GO:0006955	0.638	immune response
GO:0002682	0.619	regulation of immune system process
GO:0048523	0.613	negative regulation of cellular process
GO:0048583	0.595	regulation of response to stimulus
GO:0006968	0.511	cellular defense response
GO:0007166	0.503	cell surface receptor signaling pathway
GO:0050776	0.474	regulation of immune response
GO:0032501	0.430	multicellular organismal process
GO:0048522	0.402	positive regulation of cellular process
GO:0002684	0.394	positive regulation of immune system process
GO:0002764	0.365	immune response-regulating signaling pathway
GO:0002252	0.349	immune effector process
GO:0048584	0.329	positive regulation of response to stimulus
GO:0019222	0.323	regulation of metabolic process
GO:0051239	0.321	regulation of multicellular organismal process
GO:0044419	0.313	biological process involved in interspecies interaction between organisms
GO:0009605	0.313	response to external stimulus
GO:0009607	0.306	response to biotic stimulus
GO:0060255	0.302	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.729	intracellular membrane-bounded organelle
GO:0005737	0.562	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]