StarFunc result for job id P43631

User Input

>input (304 residues)
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLL
HREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43632	0.755	0.755	9.967E-52	304	0.918	0.918	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
2	AFDB:Q14952	0.896	0.896	1.375E-51	304	0.918	0.918	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
3	AFDB:P43626	0.766	0.674	1.459E-50	348	0.918	0.802	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
4	AFDB:P43629	0.726	0.504	3.559E-44	444	0.783	0.536	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
5	AFDB:P43630	0.652	0.439	8.401E-44	455	0.842	0.563	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
6	AFDB:Q8N743	0.635	0.472	1.392E-39	410	0.684	0.507	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
7	AFDB:Q99706	0.610	0.496	4.163E-35	377	0.622	0.501	Q99706.pdb.gz	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
8	AFDB:Q8N423	0.616	0.324	2.987E-27	598	0.395	0.201	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
9	AFDB:O75022	0.614	0.323	4.842E-27	631	0.368	0.177	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
10	AFDB:Q8NHL6	0.605	0.293	2.062E-26	650	0.398	0.186	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
11	PDB:5c6wJ	0.263	0.315	5.864E-7	238	0.102	0.130	5c6wJ.pdb.gz
12	PDB:6vpyL	0.283	0.359	1.469E-5	209	0.076	0.110	6vpyL.pdb.gz
13	PDB:1ngwH	0.272	0.342	1.549E-5	216	0.095	0.134	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
14	PDB:3bn9F	0.286	0.353	1.725E-5	224	0.112	0.152	3bn9F.pdb.gz
15	PDB:1fdlL	0.269	0.353	2.138E-5	214	0.086	0.121	1fdlL.pdb.gz
16	PDB:6jxrm	0.235	0.280	2.951E-5	248	0.128	0.157	6jxrm.pdb.gz
17	PDB:7cztH	0.282	0.367	4.296E-5	221	0.109	0.149	7cztH.pdb.gz
18	PDB:1cicA	0.254	0.338	5.047E-5	214	0.072	0.103	1cicA.pdb.gz
19	PDB:6enyC	0.230	0.199	5.325E-5	364	0.118	0.099	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.
20	PDB:1cf8L	0.278	0.371	5.929E-5	215	0.072	0.102	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F2VZG2	0.0	516	293	0.842	0.874	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
2	P43626	0.0	555	348	0.914	0.799	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
3	P43627	0.0	579	348	0.954	0.833	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
4	P43628	0.0	587	341	0.957	0.853	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
5	P43631	0.0	632	304	1.000	1.000	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
6	P43632	0.0	579	304	0.918	0.918	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
7	Q14952	0.0	575	304	0.918	0.918	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
8	Q14953	0.0	577	304	0.918	0.918	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
9	Q14954	0.0	590	304	0.938	0.938	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
10	P43629	1.84e-165	469	444	0.803	0.550	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
11	P43630	1.02e-161	460	455	0.776	0.519	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
12	Q14943	1.25e-154	439	382	0.727	0.579	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
13	Q8N743	1.22e-146	420	410	0.684	0.507	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
14	Q99706	5.78e-125	363	377	0.628	0.507	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
15	Q8NHL6	5.09e-47	169	650	0.339	0.158	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
16	Q8N423	8.36e-47	167	597	0.345	0.176	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
17	O75022	4.20e-46	166	631	0.345	0.166	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
18	O75019	3.43e-44	159	489	0.312	0.194	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
19	Q8N149	1.63e-43	157	483	0.312	0.197	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
20	Q8N6C8	2.73e-43	155	439	0.296	0.205	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	6.2e-18	76.1	Immunoglobulin domain
2	PF13895 Ig_2	0.023	26.3	Immunoglobulin domain
3	PF13927 Ig_3	0.00014	33.7	Immunoglobulin domain
4	PF16680 Ig_4	55	15.8	T-cell surface glycoprotein CD3 delta chain
5	PF07686 V-set	5.6e+02	12.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365402	0.999	HLA class I histocompatibility antigen, Cw-7 alpha chain
2	9606.ENSP00000379873	0.983	HLA class I histocompatibility antigen, A-3 alpha chain
3	9606.ENSP00000371333	0.972	Natural killer cells antigen CD94
4	9606.ENSP00000438038	0.971	NKG2-A/NKG2-B type II integral membrane protein
5	9606.ENSP00000391592	0.962	Tyrosine-protein phosphatase non-receptor type 6
6	9606.ENSP00000371327	0.960	NKG2-C type II integral membrane protein
7	9606.ENSP00000399168	0.957	HLA class I histocompatibility antigen, B-7 alpha chain
8	9606.ENSP00000452780	0.953	Beta-2-microglobulin
9	9606.ENSP00000325525	0.921	Killer cell immunoglobulin-like receptor 3DL2
10	9606.ENSP00000340944	0.914	Tyrosine-protein phosphatase non-receptor type 11
11	9606.ENSP00000336769	0.904	Killer cell immunoglobulin-like receptor 2DL1
12	9606.ENSP00000375608	0.891	Killer cell immunoglobulin-like receptor 3DL1
13	9606.ENSP00000262629	0.885	TYRO protein tyrosine kinase-binding protein
14	9606.ENSP00000365817	0.884	HLA class I histocompatibility antigen, alpha chain E
15	9606.ENSP00000310216	0.870	NKG2-F type II integral membrane protein
16	9606.ENSP00000437563	0.858	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
17	9606.ENSP00000412927	0.837	HLA class I histocompatibility antigen, alpha chain G
18	9606.ENSP00000480609	0.825	annotation not available
19	9606.ENSP00000240618	0.822	Killer cell lectin-like receptor subfamily K, member 1
20	9606.ENSP00000291860	0.809	Killer cell immunoglobulin-like receptor 3DL3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.527	signaling receptor activity
GO:0004888	0.476	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0002376	0.987	immune system process
GO:0009987	0.986	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0051716	0.974	cellular response to stimulus
GO:0006952	0.972	defense response
GO:0007166	0.940	cell surface receptor signaling pathway
GO:0048583	0.885	regulation of response to stimulus
GO:0002682	0.879	regulation of immune system process
GO:0002764	0.855	immune response-regulating signaling pathway
GO:0048518	0.807	positive regulation of biological process
GO:0002684	0.569	positive regulation of immune system process
GO:0048584	0.537	positive regulation of response to stimulus
GO:0006955	0.475	immune response
GO:0032101	0.475	regulation of response to external stimulus
GO:0050778	0.449	positive regulation of immune response
GO:0045088	0.405	regulation of innate immune response
GO:0002768	0.380	immune response-regulating cell surface receptor signaling pathway
GO:0048522	0.325	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]