StarFunc result for job id P43681

User Input

>input (627 residues)
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIR
RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKR
PSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP
SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEG
GVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSV
SPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
IFLWMFIIVCLLGTVGLFLPPWLAGMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43681	1.000	1.000	2.599E-100	627	1.000	1.000	P43681.pdb.gz	ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=CHRNA4 PE=1 SV=2
2	AFDB:P09483	0.843	0.839	1.320E-86	630	0.842	0.838	P09483.pdb.gz	ACHA4_RAT Neuronal acetylcholine receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Chrna4 PE=1 SV=3
3	AFDB:P09482	0.761	0.767	3.606E-82	622	0.740	0.746	P09482.pdb.gz	ACHA4_CHICK Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1
4	AFDB:Q0PJT8	0.675	0.675	1.705E-70	627	0.611	0.611	Q0PJT8.pdb.gz	Q0PJT8_DANRE Cholinergic receptor, nicotinic, alpha 4b OS=Danio rerio OX=7955 GN=LOC556619 PE=2 SV=1
5	AFDB:Q15822	0.637	0.754	5.232E-65	529	0.558	0.662	Q15822.pdb.gz	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
6	AFDB:B3DGY1	0.666	0.799	3.085E-64	520	0.574	0.692	B3DGY1.pdb.gz
7	AFDB:Q91X60	0.634	0.776	3.316E-62	512	0.539	0.660	Q91X60.pdb.gz	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
8	AFDB:Q15825	0.631	0.797	2.384E-57	494	0.443	0.563	Q15825.pdb.gz	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
9	AFDB:Q9R0W9	0.621	0.786	4.157E-55	494	0.427	0.543	Q9R0W9.pdb.gz	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
10	AFDB:P09481	0.628	0.790	2.086E-54	496	0.437	0.552	P09481.pdb.gz	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
11	PDB:4aq5E	0.404	0.646	5.756E-23	370	0.217	0.368	4aq5E.pdb.gz
12	PDB:6i53B	0.437	0.786	8.932E-22	338	0.113	0.210	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:6i53A	0.437	0.761	3.849E-20	349	0.094	0.169	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:2w8gC	0.303	0.844	1.490E-18	217	0.094	0.272	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
15	PDB:4hfcA	0.398	0.771	7.888E-18	311	0.091	0.183	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
16	PDB:7kuyE	0.414	0.727	2.191E-17	338	0.116	0.216	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
17	PDB:4afhA	0.296	0.838	1.986E-16	213	0.104	0.305	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:7l6qA	0.372	0.717	5.928E-14	311	0.088	0.177	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.331	0.673	2.898E-10	288	0.089	0.194	6zgdA.pdb.gz
20	PDB:4wz9B	0.098	0.077	5.894E-3	887	0.035	0.025	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0X1KG79	0.0	557	507	0.443	0.548	A0A0X1KG79_HUMAN Cholinergic receptor nicotinic alpha 2 subunit OS=Homo sapiens OX=9606 GN=CHRNA2 PE=3 SV=1
2	O70174	0.0	1024	629	0.839	0.836	ACHA4_MOUSE Neuronal acetylcholine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Chrna4 PE=1 SV=2
3	P09482	0.0	916	622	0.745	0.751	ACHA4_CHICK Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1
4	P09483	0.0	978	630	0.799	0.795	ACHA4_RAT Neuronal acetylcholine receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Chrna4 PE=1 SV=3
5	P12389	0.0	559	511	0.445	0.546	ACHA2_RAT Neuronal acetylcholine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Chrna2 PE=2 SV=2
6	P43681	0.0	1288	627	1.000	1.000	ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=CHRNA4 PE=1 SV=2
7	Q0PJT8	0.0	716	627	0.633	0.633	Q0PJT8_DANRE Cholinergic receptor, nicotinic, alpha 4b OS=Danio rerio OX=7955 GN=LOC556619 PE=2 SV=1
8	Q15822	0.0	556	529	0.443	0.526	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
9	Q1RLX8	0.0	566	520	0.443	0.535	Q1RLX8_DANRE Cholinergic receptor, nicotinic, alpha 2a (neuronal) OS=Danio rerio OX=7955 GN=zgc:136717 PE=2 SV=1
10	Q91X60	0.0	558	512	0.443	0.543	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
11	Q8R4G9	9.23e-167	487	499	0.367	0.461	ACHA3_MOUSE Neuronal acetylcholine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Chrna3 PE=2 SV=1
12	P32297	2.58e-166	486	505	0.365	0.453	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
13	P04757	3.40e-166	486	499	0.365	0.459	ACHA3_RAT Neuronal acetylcholine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Chrna3 PE=1 SV=1
14	P09481	1.88e-162	476	496	0.360	0.456	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
15	Q9R0W9	2.30e-161	473	494	0.349	0.443	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
16	Q15825	2.50e-161	473	494	0.351	0.445	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
17	P43143	2.87e-159	468	493	0.348	0.442	ACHA6_RAT Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1
18	P12391	8.86e-144	427	464	0.332	0.448	ACHB3_RAT Neuronal acetylcholine receptor subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Chrnb3 PE=2 SV=1
19	P26152	2.33e-143	426	454	0.327	0.452	ACHA5_CHICK Neuronal acetylcholine receptor subunit alpha-5 OS=Gallus gallus OX=9031 GN=CHRNA5 PE=1 SV=2
20	Q8BMN3	1.10e-142	424	464	0.332	0.448	ACHB3_MOUSE Neuronal acetylcholine receptor subunit beta-3 OS=Mus musculus OX=10090 GN=Chrnb3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	4e-73	257.0	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	3e-103	356.6	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359285

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357461	0.983	Neuronal acetylcholine receptor subunit beta-2
2	9606.ENSP00000261751	0.938	Neuronal acetylcholine receptor subunit beta-4
3	9606.ENSP00000407546	0.928	Neuronal acetylcholine receptor subunit alpha-7
4	9606.ENSP00000312663	0.910	Neuronal acetylcholine receptor subunit alpha-9
5	9606.ENSP00000315602	0.906	Neuronal acetylcholine receptor subunit alpha-3
6	9606.ENSP00000385026	0.906	Neuronal acetylcholine receptor subunit alpha-2
7	9606.ENSP00000289957	0.822	Neuronal acetylcholine receptor subunit beta-3
8	9606.ENSP00000276410	0.813	Neuronal acetylcholine receptor subunit alpha-6
9	9606.ENSP00000352035	0.811	Potassium voltage-gated channel subfamily KQT member 2
10	9606.ENSP00000371067	0.807	Tyrosine-protein kinase JAK2
11	9606.ENSP00000304290	0.741	Acetylcholine receptor subunit beta
12	9606.ENSP00000308820	0.723	Protein RIC-3
13	9606.ENSP00000360822	0.709	Potassium channel subfamily T member 1
14	9606.ENSP00000299847	0.661	CHRNA7-FAM7A fusion protein
15	9606.ENSP00000299565	0.660	Neuronal acetylcholine receptor subunit alpha-5
16	9606.ENSP00000373648	0.660	Potassium voltage-gated channel subfamily KQT member 3
17	9606.ENSP00000176183	0.659	Dopamine receptor D4
18	9606.ENSP00000263160	0.659	Vesicular glutamate transporter 2
19	9606.ENSP00000363661	0.651	Immunoglobulin-binding protein 1
20	9606.ENSP00000246515	0.649	Secreted Ly-6/uPAR-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022848	1.000	acetylcholine-gated monoatomic cation-selective channel activity
GO:0005515	0.999	protein binding
GO:0015464	0.999	acetylcholine receptor activity
GO:0042166	0.995	acetylcholine binding
GO:0015318	0.655	inorganic molecular entity transmembrane transporter activity
GO:1901702	0.607	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.991	cellular process
GO:0042391	0.990	regulation of membrane potential
GO:0050896	0.976	response to stimulus
GO:0050789	0.960	regulation of biological process
GO:0023052	0.938	signaling
GO:0007154	0.934	cell communication
GO:0050794	0.933	regulation of cellular process
GO:0042221	0.848	response to chemical
GO:0051716	0.845	cellular response to stimulus
GO:0099536	0.696	synaptic signaling
GO:0051899	0.649	membrane depolarization
GO:0032501	0.557	multicellular organismal process
GO:0007165	0.486	signal transduction
GO:0051179	0.471	localization
GO:0051234	0.439	establishment of localization
GO:0006810	0.433	transport
GO:0099537	0.407	trans-synaptic signaling
GO:0098916	0.398	anterograde trans-synaptic signaling
GO:0007268	0.384	chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043235	0.995	receptor complex
GO:1902495	0.995	transmembrane transporter complex
GO:0098797	0.995	plasma membrane protein complex
GO:0034702	0.994	ion channel complex
GO:0005892	0.976	acetylcholine-gated channel complex
GO:0005622	0.660	intracellular anatomical structure
GO:0043226	0.499	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]