StarFunc result for job id P43686

User Input

>input (418 residues)
MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K2M0	0.831	0.831	1.183E-79	418	1.000	1.000	A8K2M0.pdb.gz	A8K2M0_HUMAN Proteasome (Prosome, macropain) 26S subunit, ATPase, 4, isoform CRA_b OS=Homo sapiens OX=9606 GN=PSMC4 PE=2 SV=1
2	AFDB:Q9V405	0.768	0.777	1.367E-72	413	0.852	0.862	Q9V405.pdb.gz	Q9V405_DROME 26S proteasome regulatory complex subunit p48A OS=Drosophila melanogaster OX=7227 GN=Rpt3 PE=1 SV=1
3	AFDB:Q9SEI4	0.877	0.898	1.755E-70	408	0.763	0.782	Q9SEI4.pdb.gz	PRS6B_ARATH 26S proteasome regulatory subunit 6B homolog OS=Arabidopsis thaliana OX=3702 GN=RPT3 PE=1 SV=1
4	AFDB:P34123	0.879	0.910	8.054E-68	403	0.720	0.747	P34123.pdb.gz	PRS6B_DICDI 26S proteasome regulatory subunit 6B homolog OS=Dictyostelium discoideum OX=44689 GN=psmC4 PE=1 SV=1
5	AFDB:O74894	0.853	0.914	2.148E-64	389	0.684	0.735	O74894.pdb.gz	PRS6B_SCHPO 26S proteasome regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpt3 PE=3 SV=1
6	AFDB:D6XHJ3	0.807	0.835	2.290E-63	403	0.632	0.655	D6XHJ3.pdb.gz	D6XHJ3_TRYB2 Proteasome regulatory ATPase subunit 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.520 PE=3 SV=1
7	PDB:5l4gK	0.728	0.769	6.887E-62	393	0.940	1.000	5l4gK.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
8	AFDB:P33298	0.764	0.747	2.766E-61	428	0.675	0.659	P33298.pdb.gz	PRS6B_YEAST 26S proteasome regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT3 PE=1 SV=2
9	AFDB:Q9SL67	0.735	0.696	1.372E-53	443	0.455	0.429	Q9SL67.pdb.gz	PRS4B_ARATH 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT2B PE=1 SV=1
10	AFDB:O16368	0.738	0.699	2.674E-53	443	0.450	0.424	O16368.pdb.gz	PRS4_CAEEL Probable 26S proteasome regulatory subunit 4 OS=Caenorhabditis elegans OX=6239 GN=rpt-2 PE=3 SV=1
11	AFDB:Q55BV5	0.738	0.705	4.346E-53	439	0.469	0.446	Q55BV5.pdb.gz	PRS4_DICDI 26S proteasome regulatory subunit 4 homolog OS=Dictyostelium discoideum OX=44689 GN=psmC1 PE=1 SV=1
12	PDB:6fvtK	0.729	0.769	3.654E-52	394	0.648	0.688	6fvtK.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
13	PDB:5mp9I	0.650	0.698	7.292E-45	385	0.459	0.499	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
14	PDB:6msjB	0.726	0.737	2.318E-43	411	0.443	0.450	6msjB.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
15	PDB:5l4gM	0.747	0.752	1.201E-40	415	0.378	0.381	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
16	PDB:5l4gL	0.703	0.751	1.531E-40	389	0.378	0.406	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
17	PDB:5mp9L	0.687	0.736	2.818E-39	388	0.371	0.399	5mp9L.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
18	PDB:6fvtM	0.723	0.718	2.218E-38	421	0.361	0.359	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
19	PDB:5mp9M	0.723	0.784	2.226E-37	381	0.359	0.394	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
20	PDB:6msgF	0.691	0.726	3.035E-35	395	0.376	0.397	6msgF.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K2M0	0.0	854	418	1.000	1.000	A8K2M0_HUMAN Proteasome (Prosome, macropain) 26S subunit, ATPase, 4, isoform CRA_b OS=Homo sapiens OX=9606 GN=PSMC4 PE=2 SV=1
2	D6XHJ3	0.0	557	403	0.627	0.650	D6XHJ3_TRYB2 Proteasome regulatory ATPase subunit 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.520 PE=3 SV=1
3	O74894	0.0	593	389	0.684	0.735	PRS6B_SCHPO 26S proteasome regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpt3 PE=3 SV=1
4	P33298	0.0	577	428	0.689	0.673	PRS6B_YEAST 26S proteasome regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT3 PE=1 SV=2
5	P34123	0.0	632	403	0.722	0.749	PRS6B_DICDI 26S proteasome regulatory subunit 6B homolog OS=Dictyostelium discoideum OX=44689 GN=psmC4 PE=1 SV=1
6	P43686	0.0	854	418	1.000	1.000	PRS6B_HUMAN 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2
7	P54775	0.0	852	418	0.998	0.998	PRS6B_MOUSE 26S proteasome regulatory subunit 6B OS=Mus musculus OX=10090 GN=Psmc4 PE=1 SV=2
8	Q63570	0.0	852	418	0.998	0.998	PRS6B_RAT 26S proteasome regulatory subunit 6B OS=Rattus norvegicus OX=10116 GN=Psmc4 PE=1 SV=1
9	Q9NC98	0.0	557	403	0.627	0.650	Q9NC98_9TRYP Proteasome regulatory ATPase subunit 3 OS=Trypanosoma brucei OX=5691 GN=Rpt3 PE=3 SV=1
10	Q9SEI4	0.0	667	408	0.761	0.779	PRS6B_ARATH 26S proteasome regulatory subunit 6B homolog OS=Arabidopsis thaliana OX=3702 GN=RPT3 PE=1 SV=1
11	Q9V405	0.0	735	413	0.856	0.867	Q9V405_DROME 26S proteasome regulatory complex subunit p48A OS=Drosophila melanogaster OX=7227 GN=Rpt3 PE=1 SV=1
12	Q53HB3	1.01e-136	400	440	0.447	0.425	Q53HB3_HUMAN Proteasome 26S ATPase subunit 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
13	P62191	1.15e-136	400	440	0.447	0.425	PRS4_HUMAN 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1
14	P62192	1.15e-136	400	440	0.447	0.425	PRS4_MOUSE 26S proteasome regulatory subunit 4 OS=Mus musculus OX=10090 GN=Psmc1 PE=1 SV=1
15	P62193	1.15e-136	400	440	0.447	0.425	PRS4_RAT 26S proteasome regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Psmc1 PE=1 SV=1
16	Q53XL8	1.15e-136	400	440	0.447	0.425	Q53XL8_HUMAN Proteasome (Prosome, macropain) 26S subunit, ATPase, 1 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1
17	P48601	1.28e-136	400	439	0.450	0.428	PRS4_DROME 26S proteasome regulatory subunit 4 OS=Drosophila melanogaster OX=7227 GN=Rpt2 PE=1 SV=2
18	Q55BV5	1.08e-135	398	439	0.457	0.435	PRS4_DICDI 26S proteasome regulatory subunit 4 homolog OS=Dictyostelium discoideum OX=44689 GN=psmC1 PE=1 SV=1
19	Q9SZD4	6.81e-135	396	443	0.462	0.436	PRS4A_ARATH 26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT2A PE=1 SV=1
20	O16368	2.71e-134	394	443	0.447	0.422	PRS4_CAEEL Probable 26S proteasome regulatory subunit 4 OS=Caenorhabditis elegans OX=6239 GN=rpt-2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	4.2e-41	151.9	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	1.6	20.2	AAA domain
3	PF13191 AAA_16	0.017	27.0	AAA ATPase domain
4	PF13207 AAA_17	1.6e+02	14.2	AAA domain
5	PF13238 AAA_18	3.5	19.6	AAA domain
6	PF07724 AAA_2	4.2e-05	35.2	AAA domain (Cdc48 subfamily)
7	PF13401 AAA_22	0.81	21.4	AAA domain
8	PF13476 AAA_23	1.8e+02	14.0	AAA domain
9	PF13479 AAA_24	1.2e+02	13.8	AAA domain
10	PF13481 AAA_25	1.2e+02	13.6	AAA domain
11	PF13521 AAA_28	3.2	19.4	AAA domain
12	PF07726 AAA_3	28	16.0	ATPase family associated with various cellular activities (AAA)
13	PF13604 AAA_30	5.7e+02	11.6	AAA domain
14	PF13671 AAA_33	12	17.5	AAA domain
15	PF07728 AAA_5	0.0003	32.3	AAA domain (dynein-related subfamily)
16	PF12775 AAA_7	53	14.8	P-loop containing dynein motor region
17	PF17862 AAA_lid_3	2.9e-06	38.4	AAA+ lid domain
18	PF00005 ABC_tran	4.8e+02	12.7	ABC transporter
19	PF01637 ATPase_2	68	14.8	ATPase domain predominantly from Archaea
20	PF10473 CENP-F_leu_zip	28	16.2	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010612801.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010604081.1	0.999	Proteasome subunit beta type-6 isoform X1
2	885580.XP_010604271.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
3	885580.XP_010604871.1	0.999	26S proteasome non-ATPase regulatory subunit 6
4	885580.XP_010605135.1	0.999	26S proteasome non-ATPase regulatory subunit 14
5	885580.XP_010606453.1	0.999	26S proteasome non-ATPase regulatory subunit 1
6	885580.XP_010609155.1	0.999	Proteasome subunit alpha type
7	885580.XP_010610663.1	0.999	26S proteasome non-ATPase regulatory subunit 7
8	885580.XP_010610716.1	0.999	26S protease regulatory subunit 6A
9	885580.XP_010611812.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
10	885580.XP_010613521.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
11	885580.XP_010614594.1	0.999	Belongs to the AAA ATPase family.
12	885580.XP_010614788.1	0.999	26S proteasome non-ATPase regulatory subunit 4
13	885580.XP_010614810.1	0.999	Belongs to the peptidase T1B family.
14	885580.XP_010615042.1	0.999	26S protease regulatory subunit 8 isoform X1
15	885580.XP_010615100.1	0.999	26S proteasome non-ATPase regulatory subunit 12
16	885580.XP_010617770.1	0.999	Belongs to the peptidase T1A family
17	885580.XP_010618373.1	0.999	Proteasome subunit beta type-3
18	885580.XP_010618585.1	0.999	Uncharacterized protein LOC104859590
19	885580.XP_010622564.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
20	885580.XP_010627228.1	0.999	Proteasome subunit beta type-1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0140657	0.979	ATP-dependent activity
GO:0003824	0.950	catalytic activity
GO:0016787	0.498	hydrolase activity
GO:0016887	0.376	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0019538	0.990	protein metabolic process
GO:0009987	0.944	cellular process
GO:0006508	0.928	proteolysis
GO:0044237	0.619	cellular metabolic process
GO:0044260	0.509	cellular macromolecule metabolic process
GO:0050789	0.502	regulation of biological process
GO:0050794	0.478	regulation of cellular process
GO:0050896	0.461	response to stimulus
GO:0032501	0.391	multicellular organismal process
GO:0019222	0.386	regulation of metabolic process
GO:0032502	0.384	developmental process
GO:0060255	0.356	regulation of macromolecule metabolic process
GO:0051171	0.350	regulation of nitrogen compound metabolic process
GO:0031323	0.349	regulation of cellular metabolic process
GO:0080090	0.348	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:1902494	0.998	catalytic complex
GO:0140535	0.998	intracellular protein-containing complex
GO:0005654	0.997	nucleoplasm
GO:1905369	0.980	endopeptidase complex
GO:0000502	0.944	proteasome complex
GO:0016020	0.900	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.498	Hydrolases.
RHEA:13065	0.376	ATP + H2O = ADP + H(+) + phosphate

[back to server]