StarFunc result for job id P43694

User Input

>input (442 residues)
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAG
SASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAA
AAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNA
CGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMK
LHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNSSNATTSSSEE
MRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQT
SSKQDSWNSLVLADSHGDIITA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I3LUZ9	0.290	0.290	3.128E-59	442	0.941	0.941	I3LUZ9.pdb.gz	I3LUZ9_PIG GATA binding protein 4 OS=Sus scrofa OX=9823 GN=GATA4 PE=4 SV=2
2	AFDB:A0A087WZ09	0.276	0.277	9.524E-56	441	0.885	0.887	A0A087WZ09.pdb.gz	A0A087WZ09_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=1
3	AFDB:Q55C49	0.075	0.041	7.594E-3	1006	0.190	0.083	Q55C49.pdb.gz	GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum OX=44689 GN=gtaG PE=4 SV=1
4	PDB:5dkaA	0.075	0.290	4.558E-2	96	0.048	0.219	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
5	AFDB:A0A1C7CYY7	0.080	0.066	4.800E-1	577	0.154	0.118	A0A1C7CYY7.pdb.gz	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
6	AFDB:O70494	0.080	0.053	5.138E-1	783	0.161	0.091	O70494.pdb.gz	SP3_MOUSE Transcription factor Sp3 OS=Mus musculus OX=10090 GN=Sp3 PE=1 SV=2
7	PDB:1imlA	0.075	0.323	5.267E-1	76	0.032	0.184	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
8	PDB:2pv0B	0.068	0.082	5.267E-1	347	0.043	0.055	2pv0B.pdb.gz	DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
9	PDB:4r8pL	0.081	0.129	5.637E-1	254	0.036	0.063	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
10	PDB:7zs96	0.074	0.085	7.919E-1	383	0.041	0.047	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
11	AFDB:A0A2R8RT96	0.069	0.031	8.268E-1	1175	0.140	0.053	A0A2R8RT96.pdb.gz
12	PDB:1b8tA	0.082	0.156	1.039	192	0.061	0.141	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1q3bA	0.050	0.071	1.274	259	0.025	0.042	1q3bA.pdb.gz	Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
14	PDB:6ft6u	0.091	0.200	1.460	150	0.038	0.113	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
15	PDB:7ad8D	0.062	0.095	1.790	280	0.052	0.082	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
16	PDB:3n71A	0.070	0.066	1.916	468	0.018	0.017	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
17	AFDB:A0A024R0Q5	0.055	0.038	2.626	828	0.215	0.115	A0A024R0Q5.pdb.gz
18	AFDB:Q9SJ62	0.070	0.071	2.626	432	0.138	0.141	Q9SJ62.pdb.gz	WDL4_ARATH Protein WVD2-like 4 OS=Arabidopsis thaliana OX=3702 GN=WDL4 PE=1 SV=2
19	AFDB:O75154	0.070	0.046	3.008	756	0.176	0.103	O75154.pdb.gz	RFIP3_HUMAN Rab11 family-interacting protein 3 OS=Homo sapiens OX=9606 GN=RAB11FIP3 PE=1 SV=1
20	AFDB:E9QAP7	0.063	0.039	3.220	1042	0.208	0.088	E9QAP7.pdb.gz	E9QAP7_MOUSE TATA-box binding protein associated factor 4 OS=Mus musculus OX=10090 GN=Taf4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WZ09	0.0	629	441	0.821	0.823	A0A087WZ09_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=1
2	I3LUZ9	0.0	696	443	0.941	0.939	I3LUZ9_PIG GATA binding protein 4 OS=Sus scrofa OX=9823 GN=GATA4 PE=4 SV=2
3	P43694	0.0	882	442	1.000	1.000	GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens OX=9606 GN=GATA4 PE=1 SV=2
4	P46152	0.0	675	440	0.914	0.918	GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus OX=10116 GN=Gata4 PE=1 SV=1
5	Q08369	0.0	678	441	0.914	0.916	GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus OX=10090 GN=Gata4 PE=1 SV=4
6	Q8MIM5	0.0	698	442	0.939	0.939	Q8MIM5_PIG Transcription factor GATA-4 OS=Sus scrofa OX=9823 PE=2 SV=1
7	P43691	4.96e-173	491	380	0.609	0.708	GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus OX=9031 GN=GATA4 PE=2 SV=1
8	Q91677	1.94e-172	490	392	0.606	0.684	GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis OX=8355 GN=gata4 PE=2 SV=1
9	Q09JY7	4.46e-119	353	352	0.498	0.625	Q09JY7_DANRE GATA4 OS=Danio rerio OX=7955 GN=gata PE=2 SV=1
10	P43695	2.88e-106	322	390	0.473	0.536	GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis OX=8355 GN=gata5-a PE=2 SV=1
11	Q61169	1.02e-101	317	589	0.509	0.382	GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus OX=10090 GN=Gata6 PE=1 SV=3
12	P46153	1.65e-100	313	587	0.509	0.383	GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus OX=10116 GN=Gata6 PE=1 SV=2
13	Q92908	3.42e-99	310	595	0.505	0.375	GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens OX=9606 GN=GATA6 PE=1 SV=2
14	Q9W6U0	1.08e-97	300	383	0.434	0.501	Q9W6U0_DANRE GATA-binding protein 5 OS=Danio rerio OX=7955 GN=cb634 PE=2 SV=2
15	Q6NW63	5.29e-94	294	501	0.371	0.327	Q6NW63_DANRE GATA-binding protein 6 OS=Danio rerio OX=7955 GN=GATA-5 PE=2 SV=2
16	P70005	8.30e-94	290	391	0.378	0.427	GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis OX=8355 GN=gata6-b PE=2 SV=1
17	P43692	1.38e-93	289	391	0.480	0.542	GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus OX=9031 GN=GATA5 PE=1 SV=1
18	F1NZV5	1.13e-92	287	391	0.466	0.527	F1NZV5_CHICK GATA binding protein 5 OS=Gallus gallus OX=9031 GN=GATA5 PE=4 SV=3
19	P97489	3.50e-92	286	404	0.448	0.490	GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus OX=10090 GN=Gata5 PE=1 SV=2
20	Q9BWX5	7.28e-87	272	397	0.466	0.519	GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens OX=9606 GN=GATA5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12773 DZR	5.1e+02	12.1	Double zinc ribbon
2	PF18912 DZR_2	82	14.5	Double zinc ribbon domain
3	PF00320 GATA	1.6e-25	99.7	GATA zinc finger
4	PF05349 GATA-N	5.3e-46	168.6	GATA-type transcription activator, N-terminal
5	PF08271 TF_Zn_Ribbon	0.017	25.9	TFIIB zinc-binding
6	PF09723 Zn-ribbon_8	3.1e+02	12.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334458

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327758	0.999	Homeobox protein Nkx-2.5
2	9606.ENSP00000384179	0.999	Zinc finger protein ZFPM2
3	9606.ENSP00000340874	0.997	Myocyte-specific enhancer factor 2C
4	9606.ENSP00000341551	0.997	Mothers against decapentaplegic homolog 4
5	9606.ENSP00000263253	0.996	Histone acetyltransferase p300
6	9606.ENSP00000309913	0.995	T-box transcription factor TBX5
7	9606.ENSP00000265354	0.992	Serum response factor
8	9606.ENSP00000388910	0.991	Nuclear factor of activated T-cells, cytoplasmic 4
9	9606.ENSP00000362690	0.988	Steroidogenic factor 1
10	9606.ENSP00000389377	0.980	Nuclear factor of activated T-cells, cytoplasmic 1
11	9606.ENSP00000338272	0.979	Hairy/enhancer-of-split related with YRPW motif protein 1
12	9606.ENSP00000245451	0.977	Bone morphogenetic protein 4
13	9606.ENSP00000357348	0.973	Hairy/enhancer-of-split related with YRPW motif protein 2
14	9606.ENSP00000365663	0.973	Natriuretic peptides A
15	9606.ENSP00000262188	0.972	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
16	9606.ENSP00000221496	0.966	Muellerian-inhibiting factor
17	9606.ENSP00000352565	0.964	Heart- and neural crest derivatives-expressed protein 2
18	9606.ENSP00000228841	0.963	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
19	9606.ENSP00000368104	0.962	Bone morphogenetic protein 2
20	9606.ENSP00000371711	0.955	Doublesex- and mab-3-related transcription factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0003700	0.968	DNA-binding transcription factor activity
GO:0005515	0.960	protein binding
GO:0000981	0.919	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.794	transcription factor binding
GO:0000987	0.746	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.677	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140297	0.647	DNA-binding transcription factor binding
GO:0000978	0.553	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0061629	0.512	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.995	positive regulation of cellular process
GO:0010604	0.995	positive regulation of macromolecule metabolic process
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0045893	0.990	positive regulation of DNA-templated transcription
GO:0009987	0.978	cellular process
GO:0032502	0.938	developmental process
GO:0032501	0.932	multicellular organismal process
GO:0048856	0.925	anatomical structure development
GO:0006357	0.836	regulation of transcription by RNA polymerase II
GO:0050896	0.827	response to stimulus
GO:0045944	0.794	positive regulation of transcription by RNA polymerase II
GO:0007275	0.761	multicellular organism development
GO:0048513	0.728	animal organ development
GO:0048731	0.727	system development
GO:0048519	0.616	negative regulation of biological process
GO:0007507	0.588	heart development
GO:0030154	0.576	cell differentiation
GO:0009653	0.562	anatomical structure morphogenesis
GO:0048523	0.556	negative regulation of cellular process
GO:0009888	0.544	tissue development
GO:0051716	0.508	cellular response to stimulus
GO:0048583	0.399	regulation of response to stimulus
GO:0051239	0.393	regulation of multicellular organismal process
GO:0010646	0.393	regulation of cell communication
GO:0023051	0.388	regulation of signaling
GO:0050793	0.375	regulation of developmental process
GO:0060429	0.363	epithelium development
GO:0009966	0.354	regulation of signal transduction
GO:0009892	0.353	negative regulation of metabolic process
GO:0042221	0.324	response to chemical
GO:0007154	0.320	cell communication
GO:0010605	0.310	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.967	intracellular organelle lumen
GO:0005654	0.936	nucleoplasm
GO:0005737	0.355	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]