StarFunc result for job id P43699

User Input

>input (371 residues)
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGH
HGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDP
RFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRF
KQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGG
GTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAA
AAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTM
SCSTLLYGRTW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23441	0.600	0.598	1.035E-48	372	0.989	0.987	P23441.pdb.gz	NKX21_RAT Homeobox protein Nkx-2.1 OS=Rattus norvegicus OX=10116 GN=Nkx2-1 PE=1 SV=1
2	AFDB:B3DH68	0.366	0.387	1.712E-33	346	0.685	0.734	B3DH68.pdb.gz
3	AFDB:A8KB41	0.296	0.316	2.393E-27	345	0.577	0.620	A8KB41.pdb.gz	A8KB41_DANRE Homeobox protein Nkx-2.4 isoform 1 OS=Danio rerio OX=7955 GN=fi48a12 PE=2 SV=1
4	AFDB:Q58A08	0.277	0.297	7.699E-24	344	0.558	0.602	Q58A08.pdb.gz	Q58A08_ONCMY NK2 homeobox 1b OS=Oncorhynchus mykiss OX=8022 GN=Nkx2-4b PE=2 SV=1
5	AFDB:P52952	0.233	0.264	1.077E-9	324	0.342	0.392	P52952.pdb.gz	NKX25_HUMAN Homeobox protein Nkx-2.5 OS=Homo sapiens OX=9606 GN=NKX2-5 PE=1 SV=1
6	AFDB:Q14774	0.202	0.157	5.001E-9	488	0.245	0.186	Q14774.pdb.gz	HLX_HUMAN H2.0-like homeobox protein OS=Homo sapiens OX=9606 GN=HLX PE=1 SV=3
7	AFDB:Q03356	0.178	0.253	1.838E-7	257	0.191	0.276	Q03356.pdb.gz	MSXB_DANRE Homeobox protein MSH-B OS=Danio rerio OX=7955 GN=msxb PE=2 SV=3
8	AFDB:P42580	0.154	0.187	2.246E-7	305	0.216	0.262	P42580.pdb.gz	NKX12_MOUSE NK1 transcription factor-related protein 2 OS=Mus musculus OX=10090 GN=Nkx1-2 PE=1 SV=1
9	AFDB:Q9PTU1	0.187	0.216	5.002E-7	314	0.191	0.226	Q9PTU1.pdb.gz	DBX1A_DANRE Homeobox protein DBX1-A OS=Danio rerio OX=7955 GN=dbx1a PE=2 SV=1
10	AFDB:P35548	0.186	0.252	5.348E-7	267	0.197	0.273	P35548.pdb.gz	MSX2_HUMAN Homeobox protein MSX-2 OS=Homo sapiens OX=9606 GN=MSX2 PE=1 SV=3
11	PDB:4egcA	0.129	0.089	1.683E-2	539	0.040	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.138	0.608	6.837E-2	73	0.040	0.205	2hi3A.pdb.gz
13	PDB:5aj0BZ	0.114	0.411	6.187E-1	86	0.027	0.116	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
14	PDB:7fbyA	0.105	0.230	6.614E-1	153	0.022	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5nr5A	0.098	0.288	9.234E-1	113	0.051	0.168	5nr5A.pdb.gz
16	PDB:2cg4A	0.102	0.226	1.289	149	0.016	0.040	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:5mrca	0.080	0.151	1.473	177	0.046	0.096	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
18	PDB:2ffhA	0.114	0.105	1.684	407	0.027	0.025	2ffhA.pdb.gz
19	PDB:2cjjA	0.126	0.635	2.057	63	0.024	0.143	2cjjA.pdb.gz
20	PDB:7awtE	0.090	0.199	2.057	156	0.016	0.038	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23441	0.0	733	372	0.989	0.987	NKX21_RAT Homeobox protein Nkx-2.1 OS=Rattus norvegicus OX=10116 GN=Nkx2-1 PE=1 SV=1
2	P43699	0.0	747	371	1.000	1.000	NKX21_HUMAN Homeobox protein Nkx-2.1 OS=Homo sapiens OX=9606 GN=NKX2-1 PE=1 SV=1
3	P50220	0.0	729	372	0.984	0.981	NKX21_MOUSE Homeobox protein Nkx-2.1 OS=Mus musculus OX=10090 GN=Nkx2-1 PE=2 SV=1
4	Q98TX4	1.54e-173	488	346	0.682	0.731	Q98TX4_DANRE Homeobox protein Nkx-2.1 OS=Danio rerio OX=7955 GN=nk2.1b PE=2 SV=1
5	A8KB41	1.37e-142	410	345	0.580	0.623	A8KB41_DANRE Homeobox protein Nkx-2.4 isoform 1 OS=Danio rerio OX=7955 GN=fi48a12 PE=2 SV=1
6	Q58A07	2.01e-135	391	339	0.585	0.640	Q58A07_ONCMY Transcription factor Nkx2-4a OS=Oncorhynchus mykiss OX=8022 GN=Nkx2-4a PE=2 SV=1
7	B3DG22	1.16e-134	389	336	0.561	0.619	B3DG22_DANRE Homeobox protein Nkx-2.4 isoform 2 OS=Danio rerio OX=7955 GN=LOC100148014 PE=2 SV=1
8	Q58A09	3.03e-129	376	344	0.561	0.605	Q58A09_ONCMY Transcription factor Nkx2-4c OS=Oncorhynchus mykiss OX=8022 GN=Nkx2-4c PE=2 SV=1
9	Q58A08	3.53e-129	376	344	0.563	0.608	Q58A08_ONCMY NK2 homeobox 1b OS=Oncorhynchus mykiss OX=8022 GN=Nkx2-4b PE=2 SV=1
10	Q9I8L7	8.09e-119	348	307	0.539	0.651	Q9I8L7_DANRE Homeobox protein OS=Danio rerio OX=7955 GN=nk2.1a PE=2 SV=1
11	Q9H2Z4	3.13e-102	307	354	0.485	0.508	NKX24_HUMAN Homeobox protein Nkx-2.4 OS=Homo sapiens OX=9606 GN=NKX2-4 PE=1 SV=3
12	O14956	9.67e-83	249	126	0.329	0.968	O14956_HUMAN Thyroid transcriptional factor-1 truncated form OS=Homo sapiens OX=9606 PE=2 SV=1
13	Q7PL95	6.17e-69	226	468	0.369	0.293	Q7PL95_DROME Scarecrow, isoform A OS=Drosophila melanogaster OX=7227 GN=scro PE=4 SV=1
14	Q9NCG1	6.25e-69	223	380	0.369	0.361	Q9NCG1_DROME Homeobox protein Scarecrow (Fragment) OS=Drosophila melanogaster OX=7227 GN=scro PE=2 SV=1
15	A8Y527	1.75e-59	196	307	0.315	0.381	A8Y527_DROME Scarecrow, isoform F OS=Drosophila melanogaster OX=7227 GN=scro PE=4 SV=2
16	A8Y525	8.01e-48	169	439	0.315	0.267	A8Y525_DROME Scarecrow, isoform C OS=Drosophila melanogaster OX=7227 GN=scro PE=4 SV=1
17	Q90481	3.23e-41	147	269	0.218	0.301	NX22A_DANRE Homeobox protein Nkx-2.2a OS=Danio rerio OX=7955 GN=nkx2.2a PE=2 SV=1
18	D3ZDQ2	3.04e-40	145	273	0.221	0.300	D3ZDQ2_RAT NK2 homeobox 2 OS=Rattus norvegicus OX=10116 GN=Nkx2-2 PE=4 SV=1
19	P42586	3.79e-40	145	273	0.221	0.300	NKX22_MOUSE Homeobox protein Nkx-2.2 OS=Mus musculus OX=10090 GN=Nkx2-2 PE=1 SV=2
20	O95096	4.83e-40	144	273	0.221	0.300	NKX22_HUMAN Homeobox protein Nkx-2.2 OS=Homo sapiens OX=9606 GN=NKX2-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	2.8e+02	12.8	Homeobox KN domain
2	PF00046 Homeodomain	5.6e-17	72.7	Homeodomain
3	PF06682 SARAF	3e+02	12.4	SOCE-associated regulatory factor of calcium homoeostasis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346879

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250448	0.966	Hepatocyte nuclear factor 3-alpha
2	9606.ENSP00000263334	0.927	Paired box protein Pax-8
3	9606.ENSP00000332973	0.902	Mothers against decapentaplegic homolog 3
4	9606.ENSP00000385216	0.900	Nuclear receptor coactivator 1
5	9606.ENSP00000253719	0.861	Napsin-A
6	9606.ENSP00000329243	0.856	Keratin, type II cytoskeletal 7
7	9606.ENSP00000220616	0.850	Thyroglobulin
8	9606.ENSP00000377854	0.846	LIM/homeobox protein Lhx6
9	9606.ENSP00000400341	0.833	Hepatocyte nuclear factor 3-beta
10	9606.ENSP00000386346	0.796	Pulmonary surfactant-associated protein B
11	9606.ENSP00000364265	0.788	Forkhead box protein E1
12	9606.ENSP00000316152	0.776	Pulmonary surfactant-associated protein C
13	9606.ENSP00000167588	0.770	Keratin, type I cytoskeletal 20
14	9606.ENSP00000269216	0.767	Transcription factor GATA-6
15	9606.ENSP00000441235	0.761	Thyrotropin receptor
16	9606.ENSP00000363149	0.754	SAM pointed domain-containing Ets transcription factor
17	9606.ENSP00000263233	0.753	Synaptophysin
18	9606.ENSP00000183605	0.739	Claudin-18
19	9606.ENSP00000252242	0.735	Keratin, type II cytoskeletal 5
20	9606.ENSP00000386200	0.730	Forkhead box protein P2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.881	transcription factor binding
GO:0001046	0.845	core promoter sequence-specific DNA binding
GO:0001228	0.838	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.772	identical protein binding
GO:0003712	0.587	transcription coregulator activity
GO:0003713	0.575	transcription coactivator activity
GO:0001221	0.570	transcription coregulator binding
GO:0017025	0.550	TBP-class protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0007275	0.977	multicellular organism development
GO:0019222	0.970	regulation of metabolic process
GO:0048518	0.967	positive regulation of biological process
GO:0031323	0.949	regulation of cellular metabolic process
GO:0060255	0.885	regulation of macromolecule metabolic process
GO:0080090	0.881	regulation of primary metabolic process
GO:0051171	0.880	regulation of nitrogen compound metabolic process
GO:0009889	0.875	regulation of biosynthetic process
GO:0051252	0.868	regulation of RNA metabolic process
GO:0010468	0.867	regulation of gene expression
GO:0031326	0.867	regulation of cellular biosynthetic process
GO:0006355	0.864	regulation of DNA-templated transcription
GO:0006357	0.844	regulation of transcription by RNA polymerase II
GO:0048513	0.826	animal organ development
GO:0009987	0.799	cellular process
GO:0048522	0.786	positive regulation of cellular process
GO:0048731	0.767	system development
GO:0051173	0.717	positive regulation of nitrogen compound metabolic process
GO:0031325	0.714	positive regulation of cellular metabolic process
GO:0045944	0.703	positive regulation of transcription by RNA polymerase II
GO:0050896	0.623	response to stimulus
GO:0048519	0.421	negative regulation of biological process
GO:0048523	0.400	negative regulation of cellular process
GO:0007399	0.378	nervous system development
GO:0007417	0.326	central nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.989	protein-containing complex
GO:0070013	0.840	intracellular organelle lumen
GO:0005654	0.712	nucleoplasm
GO:0005667	0.704	transcription regulator complex
GO:0005737	0.697	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]