StarFunc result for job id P43897

User Input

>input (325 residues)
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREG
SLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVIC
ETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYV
QPQGVSVVDFVRFECGEGEEAAETE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5KS95	0.874	0.874	1.141E-63	325	1.000	1.000	E5KS95.pdb.gz	E5KS95_HUMAN Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM PE=3 SV=1
2	AFDB:Q9CZR8	0.887	0.890	2.081E-58	324	0.855	0.858	Q9CZR8.pdb.gz	EFTS_MOUSE Elongation factor Ts, mitochondrial OS=Mus musculus OX=10090 GN=Tsfm PE=1 SV=1
3	AFDB:P43896	0.905	0.870	2.162E-57	338	0.880	0.846	P43896.pdb.gz	EFTS_BOVIN Elongation factor Ts, mitochondrial OS=Bos taurus OX=9913 GN=TSFM PE=1 SV=1
4	AFDB:Q9VJC7	0.756	0.772	2.165E-31	318	0.345	0.352	Q9VJC7.pdb.gz	EFTS_DROME Elongation factor Ts, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mEFTs PE=1 SV=1
5	AFDB:Q5XF75	0.672	0.562	1.514E-22	395	0.249	0.205	Q5XF75.pdb.gz	EFTS_ARATH Elongation factor Ts, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EFTS PE=1 SV=1
6	AFDB:Q9HGL5	0.658	0.711	1.294E-20	299	0.228	0.247	Q9HGL5.pdb.gz	EFTS_SCHPO Elongation factor Ts, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tsf1 PE=3 SV=1
7	AFDB:P0A6P1	0.612	0.695	1.042E-18	283	0.237	0.272	P0A6P1.pdb.gz	EFTS_ECOLI Elongation factor Ts OS=Escherichia coli (strain K12) OX=83333 GN=tsf PE=1 SV=2
8	AFDB:Q9CDR5	0.630	0.600	2.104E-18	342	0.246	0.234	Q9CDR5.pdb.gz	EFTS_LACLA Elongation factor Ts OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=tsf PE=3 SV=1
9	AFDB:O97235	0.507	0.427	1.730E-17	390	0.231	0.192	O97235.pdb.gz	EFTS_PLAF7 Elongation factor Ts, mitochondrial OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PFC0225c PE=3 SV=2
10	AFDB:O51148	0.569	0.652	1.040E-15	279	0.203	0.237	O51148.pdb.gz	EFTS_BORBU Elongation factor Ts OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=tsf PE=3 SV=1
11	PDB:3avtA	0.584	0.173	4.481E-13	1203	0.234	0.063	3avtA.pdb.gz	Molecular basis for RNA polymerization by Q beta replicase
12	PDB:4f1iA	0.129	0.128	5.097E-2	328	0.086	0.085	4f1iA.pdb.gz
13	PDB:6c4iv	0.094	0.093	1.550E-1	362	0.083	0.075	6c4iv.pdb.gz	Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
14	PDB:2hruA	0.089	0.059	3.316E-1	581	0.065	0.036	2hruA.pdb.gz	Complexed Structures of Formylglycinamide Ribonucleotide Amidotransferase from Thermotoga maritima Describe a Novel ATP Binding Protein Superfamily
15	PDB:3ihpB	0.132	0.074	4.995E-1	681	0.046	0.022	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
16	PDB:6gxnv	0.089	0.084	4.995E-1	348	0.062	0.057	6gxnv.pdb.gz	Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
17	PDB:5ekzA	0.108	0.147	5.296E-1	221	0.095	0.140	5ekzA.pdb.gz
18	PDB:5a0qA	0.097	0.143	6.693E-1	195	0.025	0.041	5a0qA.pdb.gz	Cryo-Em Reveals the Conformation of a Substrate Analogue in the Human 20S Proteasome Core.
19	PDB:6humF	0.116	0.071	8.458E-1	611	0.037	0.020	6humF.pdb.gz	Structural adaptations of photosynthetic complex I enable ferredoxin-dependent electron transfer.
20	PDB:6jj7A	0.062	0.054	9.508E-1	465	0.022	0.015	6jj7A.pdb.gz	Crystal structure of OsHXK6-Glc complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5KS95	0.0	665	325	1.000	1.000	E5KS95_HUMAN Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM PE=3 SV=1
2	P43896	0.0	538	338	0.849	0.817	EFTS_BOVIN Elongation factor Ts, mitochondrial OS=Bos taurus OX=9913 GN=TSFM PE=1 SV=1
3	P43897	0.0	665	325	1.000	1.000	EFTS_HUMAN Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM PE=1 SV=2
4	Q9CZR8	0.0	554	324	0.855	0.858	EFTS_MOUSE Elongation factor Ts, mitochondrial OS=Mus musculus OX=10090 GN=Tsfm PE=1 SV=1
5	Q9VJC7	7.16e-57	188	318	0.338	0.346	EFTS_DROME Elongation factor Ts, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mEFTs PE=1 SV=1
6	P0A6P1	2.73e-23	99.4	283	0.255	0.293	EFTS_ECOLI Elongation factor Ts OS=Escherichia coli (strain K12) OX=83333 GN=tsf PE=1 SV=2
7	Q5XF75	3.35e-16	80.9	395	0.258	0.213	EFTS_ARATH Elongation factor Ts, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EFTS PE=1 SV=1
8	Q9SZD6	1.57e-15	79.7	953	0.138	0.047	PETS_ARATH Polyprotein of EF-Ts, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PETs PE=1 SV=1
9	A8J637	1.23e-13	73.9	1013	0.142	0.045	PETS_CHLRE Polyprotein of EF-Ts, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=PETs PE=1 SV=1
10	Q9CDR5	9.84e-13	70.1	342	0.194	0.184	EFTS_LACLA Elongation factor Ts OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=tsf PE=3 SV=1
11	Q9HGL5	6.97e-12	67.4	299	0.255	0.278	EFTS_SCHPO Elongation factor Ts, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tsf1 PE=3 SV=1
12	O51148	7.92e-08	55.1	279	0.191	0.222	EFTS_BORBU Elongation factor Ts OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=tsf PE=3 SV=1
13	P9WNM1	1.98e-07	53.9	271	0.098	0.118	EFTS_MYCTU Elongation factor Ts OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tsf PE=1 SV=1
14	Q57W99	8.07e-07	52.0	274	0.160	0.190	Q57W99_TRYB2 Elongation factor Ts, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.970 PE=3 SV=1
15	O97235	1.31e-04	45.8	390	0.188	0.156	EFTS_PLAF7 Elongation factor Ts, mitochondrial OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PFC0225c PE=3 SV=2
16	Q5THJ4	0.082	37.4	4388	0.052	0.004	VP13D_HUMAN Intermembrane lipid transfer protein VPS13D OS=Homo sapiens OX=9606 GN=VPS13D PE=1 SV=2
17	Q9I527	4.6	31.6	742	0.058	0.026	PIRA_PSEAE Ferric enterobactin receptor PirA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pirA PE=1 SV=1
18	O74113	6.0	31.2	638	0.086	0.044	CDC45_SCHPO Cell division control protein 45 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sna41 PE=1 SV=1
19	P0C460	8.6	29.3	124	0.058	0.153	RR12_ORYSA Small ribosomal subunit protein uS12cz/uS12cy OS=Oryza sativa OX=4530 GN=rps12-A PE=3 SV=1
20	P0C461	8.6	29.3	124	0.058	0.153	RR12_ORYSI Small ribosomal subunit protein uS12cz/uS12cy OS=Oryza sativa subsp. indica OX=39946 GN=rps12-A PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00889 EF_TS	9.6e-23	92.4	Elongation factor TS

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000001398

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000013798	0.993	Elongation factor Tu
2	9593.ENSGGOP00000027005	0.909	Mitochondrial ribosomal protein L19
3	9593.ENSGGOP00000011353	0.903	Programmed cell death 11
4	9593.ENSGGOP00000022021	0.900	Elongation factor G, mitochondrial
5	9593.ENSGGOP00000014695	0.881	Mitochondrial ribosomal protein S16
6	9593.ENSGGOP00000007583	0.851	Mitochondrial ribosomal protein S9
7	9593.ENSGGOP00000021862	0.841	Mitochondrial ribosome recycling factor
8	9593.ENSGGOP00000019447	0.824	Uncharacterized protein
9	9593.ENSGGOP00000016808	0.823	Mitochondrial ribosomal protein L21
10	9593.ENSGGOP00000002887	0.817	Ribosomal protein S11
11	9593.ENSGGOP00000009143	0.816	Mitochondrial ribosomal protein L12
12	9593.ENSGGOP00000001870	0.809	Mitochondrial ribosomal protein L9
13	9593.ENSGGOP00000011662	0.808	Mitochondrial ribosomal protein L27
14	9593.ENSGGOP00000006777	0.801	Mitochondrial ribosomal protein L17
15	9593.ENSGGOP00000012557	0.782	Uncharacterized protein
16	9593.ENSGGOP00000012672	0.782	Elongation factor Tu GTP binding domain containing 2
17	9593.ENSGGOP00000018064	0.782	Uncharacterized protein
18	9593.ENSGGOP00000028114	0.782	Elongation factor Tu GTP binding domain containing 1
19	9593.ENSGGOP00000007981	0.773	Ribosomal protein L8
20	9593.ENSGGOP00000010288	0.773	Mitochondrial ribosomal protein L2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.998	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.989	biological regulation
GO:0006412	0.985	translation
GO:0050794	0.971	regulation of cellular process
GO:0019222	0.966	regulation of metabolic process
GO:0031323	0.956	regulation of cellular metabolic process
GO:0010556	0.952	regulation of macromolecule biosynthetic process
GO:0031326	0.951	regulation of cellular biosynthetic process
GO:0070129	0.941	regulation of mitochondrial translation
GO:0019219	0.903	regulation of nucleobase-containing compound metabolic process
GO:0032784	0.887	regulation of DNA-templated transcription elongation
GO:0006414	0.840	translational elongation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0031981	0.995	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0016020	0.468	membrane
GO:0032991	0.463	protein-containing complex
GO:0005759	0.455	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]