StarFunc result for job id P45378

User Input

>input (269 residues)
MSDEEVEQVEEQYEEEEEAQEEAAEVHEEVHEPEEVQEDTAEEDAEEEKPRPKLTAPKIP
EGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEELVALKERIEKRRAERAEQQRI
RAEKERERQNRLAEEKARREEEDAKRRAEDDLKKKKALSSMGANYSSYLAKADQKRGKKQ
TAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDIT
TLRSRIDQAQKHSKKAGTPAKGKVGGRWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P45378	1.000	1.000	3.709E-38	269	1.000	1.000	P45378.pdb.gz	TNNT3_HUMAN Troponin T, fast skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT3 PE=1 SV=3
2	AFDB:A0A1D5NS25	0.381	0.431	1.368E-19	234	0.595	0.684	A0A1D5NS25.pdb.gz
3	AFDB:P50752	0.347	0.314	3.601E-19	301	0.621	0.555	P50752.pdb.gz	TNNT2_MOUSE Troponin T, cardiac muscle OS=Mus musculus OX=10090 GN=Tnnt2 PE=1 SV=2
4	AFDB:P13805	0.434	0.422	6.065E-19	278	0.587	0.568	P13805.pdb.gz	TNNT1_HUMAN Troponin T, slow skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT1 PE=1 SV=4
5	AFDB:P45379	0.429	0.394	1.277E-18	298	0.595	0.537	P45379.pdb.gz	TNNT2_HUMAN Troponin T, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNT2 PE=1 SV=3
6	AFDB:A8E586	0.351	0.338	5.259E-18	282	0.569	0.543	A8E586.pdb.gz
7	AFDB:A0A060XT52	0.387	0.425	5.666E-18	243	0.546	0.605	A0A060XT52.pdb.gz	A0A060XT52_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00050634001 PE=3 SV=1
8	AFDB:F1QBR1	0.375	0.414	5.666E-18	241	0.509	0.568	F1QBR1.pdb.gz
9	AFDB:Q8AVB1	0.525	0.494	4.232E-17	290	0.554	0.514	Q8AVB1.pdb.gz	Q8AVB1_DANRE Slow troponin T OS=Danio rerio OX=7955 GN=tnnt1 PE=1 SV=1
10	AFDB:Q27371	0.318	0.223	8.921E-5	405	0.242	0.160	Q27371.pdb.gz	TNNT_CAEEL Troponin T OS=Caenorhabditis elegans OX=6239 GN=mup-2 PE=2 SV=1
11	PDB:7utiY	0.243	0.795	9.119E-5	74	0.171	0.622	7utiY.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
12	PDB:7utlV	0.256	0.392	2.447E-1	170	0.082	0.129	7utlV.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
13	PDB:7tveD	0.187	0.115	7.525	445	0.045	0.027	7tveD.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
14	PDB:6xywBv	0.170	0.276	8.734	149	0.123	0.221	6xywBv.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
15	PDB:6t9iF	0.074	0.140	9.409	111	0.033	0.081	6t9iF.pdb.gz
16	PDB:7bp0a	0.061	0.042	9.409	437	0.037	0.023	7bp0a.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P45378	0.0	522	269	1.000	1.000	TNNT3_HUMAN Troponin T, fast skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT3 PE=1 SV=3
2	P09739	3.06e-142	401	259	0.792	0.822	TNNT3_RAT Troponin T, fast skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt3 PE=1 SV=2
3	Q7ZZW4	6.67e-94	278	232	0.587	0.681	Q7ZZW4_DANRE Fast muscle troponin T isoform TnnT3b OS=Danio rerio OX=7955 GN=b44 PE=1 SV=1
4	A8WGA6	5.04e-91	272	284	0.569	0.539	A8WGA6_DANRE Tnnt3b protein OS=Danio rerio OX=7955 GN=b44 PE=1 SV=1
5	Q9I8U9	1.01e-81	247	230	0.569	0.665	Q9I8U9_DANRE Fast skeletal muscle troponin T OS=Danio rerio OX=7955 GN=tnnt PE=1 SV=1
6	Q7TNB2	3.74e-81	246	261	0.565	0.582	TNNT1_RAT Troponin T, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt1 PE=1 SV=3
7	O88346	3.86e-81	246	262	0.565	0.580	TNNT1_MOUSE Troponin T, slow skeletal muscle OS=Mus musculus OX=10090 GN=Tnnt1 PE=2 SV=3
8	P50752	4.88e-78	240	301	0.558	0.498	TNNT2_MOUSE Troponin T, cardiac muscle OS=Mus musculus OX=10090 GN=Tnnt2 PE=1 SV=2
9	P50753	8.07e-78	239	299	0.558	0.502	TNNT2_RAT Troponin T, cardiac muscle OS=Rattus norvegicus OX=10116 GN=Tnnt2 PE=1 SV=2
10	P13805	1.42e-74	230	278	0.554	0.536	TNNT1_HUMAN Troponin T, slow skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT1 PE=1 SV=4
11	Q4QRC7	3.93e-74	228	241	0.480	0.535	Q4QRC7_DANRE Troponin T2d, cardiac OS=Danio rerio OX=7955 GN=zgc:114184 PE=1 SV=1
12	Q8AVB1	1.47e-69	218	290	0.491	0.455	Q8AVB1_DANRE Slow troponin T OS=Danio rerio OX=7955 GN=tnnt1 PE=1 SV=1
13	P45379	7.69e-68	214	298	0.546	0.493	TNNT2_HUMAN Troponin T, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNT2 PE=1 SV=3
14	A0A060XT52	1.28e-63	201	243	0.550	0.609	A0A060XT52_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00050634001 PE=3 SV=1
15	A0A060WB67	2.42e-61	197	305	0.539	0.475	A0A060WB67_ONCMY Troponin T type 3a (skeletal, fast) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065892001 PE=3 SV=1
16	F1R0K6	7.86e-59	189	264	0.465	0.473	F1R0K6_DANRE Troponin T type 2a (cardiac) OS=Danio rerio OX=7955 GN=cTnT PE=1 SV=1
17	Q90Y46	1.30e-58	189	282	0.461	0.440	Q90Y46_DANRE Cardiac troponin T OS=Danio rerio OX=7955 GN=tnnt2 PE=1 SV=1
18	P19351	5.87e-13	70.1	397	0.253	0.171	TNNT_DROME Troponin T, skeletal muscle OS=Drosophila melanogaster OX=7227 GN=up PE=1 SV=3
19	C1P640	0.002	41.6	3683	0.212	0.015	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
20	C1P641	0.003	41.6	3663	0.212	0.016	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14056 DUF4250	1e+02	14.3	Domain of unknown function (DUF4250)
2	PF00992 Troponin	1e-26	105.1	Troponin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008967349.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003816126.1	0.988	Troponin I2, fast skeletal type
2	9597.XP_003826032.1	0.977	Troponin C2, fast skeletal type
3	9597.XP_008974890.1	0.972	Troponin I, slow skeletal muscle
4	9597.XP_003807165.1	0.962	Troponin I3, cardiac type
5	9597.XP_003807017.1	0.958	Myosin light chain 1
6	9597.XP_008957905.1	0.958	Myosin regulatory light chain 2, skeletal muscle isoform
7	9597.XP_003818806.1	0.947	Troponin C1, slow skeletal and cardiac type
8	9597.XP_003828721.1	0.936	Alpha-actinin-3
9	9597.XP_008969594.1	0.918	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
10	9597.XP_008969596.1	0.917	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
11	9597.XP_008953480.1	0.900	Tropomyosin 2 (beta)
12	9597.XP_003827981.1	0.896	Belongs to the tropomyosin family.
13	9597.XP_008964497.1	0.894	Myosin-binding protein C, fast-type
14	9597.XP_008956276.1	0.893	Myosin binding protein C, slow type
15	9597.XP_008968759.1	0.866	Belongs to the tropomyosin family.
16	9597.XP_003824564.2	0.864	Actinin alpha 2
17	9597.XP_003824135.1	0.845	Alpha-actinin-1 isoform X1
18	9597.XP_003813612.1	0.836	Belongs to the tropomyosin family.
19	9597.XP_003818148.1	0.829	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
20	9597.XP_008969597.1	0.825	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005523	0.999	tropomyosin binding
GO:0003779	0.999	actin binding
GO:0048306	0.992	calcium-dependent protein binding
GO:0031013	0.984	troponin I binding
GO:0030172	0.941	troponin C binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.991	multicellular organismal process
GO:0065007	0.988	biological regulation
GO:0050789	0.967	regulation of biological process
GO:0006936	0.965	muscle contraction
GO:0006937	0.934	regulation of muscle contraction
GO:0009987	0.931	cellular process
GO:0006941	0.776	striated muscle contraction
GO:0050879	0.654	multicellular organismal movement
GO:0048856	0.619	anatomical structure development
GO:0006942	0.597	regulation of striated muscle contraction
GO:0030029	0.511	actin filament-based process
GO:0016043	0.449	cellular component organization
GO:0050877	0.424	nervous system process
GO:0050794	0.398	regulation of cellular process
GO:0061061	0.308	muscle structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005861	0.999	troponin complex
GO:0005829	0.968	cytosol
GO:0043227	0.536	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]