StarFunc result for job id P45379

User Input

>input (298 residues)
MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEE
EAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHF
ENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAED
EARKKKALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLR
EKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P45379	1.000	1.000	6.729E-39	298	1.000	1.000	P45379.pdb.gz	TNNT2_HUMAN Troponin T, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNT2 PE=1 SV=3
2	AFDB:A8E586	0.338	0.354	2.082E-19	282	0.591	0.624	A8E586.pdb.gz
3	AFDB:Q8AVB1	0.391	0.401	5.070E-19	290	0.567	0.583	Q8AVB1.pdb.gz	Q8AVB1_DANRE Slow troponin T OS=Danio rerio OX=7955 GN=tnnt1 PE=1 SV=1
4	AFDB:P13805	0.351	0.371	9.885E-19	278	0.517	0.554	P13805.pdb.gz	TNNT1_HUMAN Troponin T, slow skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT1 PE=1 SV=4
5	AFDB:P45378	0.370	0.405	1.543E-18	269	0.520	0.576	P45378.pdb.gz	TNNT3_HUMAN Troponin T, fast skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT3 PE=1 SV=3
6	AFDB:F1QBR1	0.589	0.715	3.229E-17	241	0.473	0.585	F1QBR1.pdb.gz
7	AFDB:A0A1D5NS25	0.333	0.409	7.281E-16	234	0.463	0.590	A0A1D5NS25.pdb.gz
8	AFDB:A0A060WB67	0.341	0.334	2.569E-15	305	0.463	0.452	A0A060WB67.pdb.gz	A0A060WB67_ONCMY Troponin T type 3a (skeletal, fast) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065892001 PE=3 SV=1
9	AFDB:A0A060XT52	0.389	0.467	5.395E-15	243	0.430	0.527	A0A060XT52.pdb.gz	A0A060XT52_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00050634001 PE=3 SV=1
10	AFDB:Q9I8U9	0.385	0.484	8.420E-15	230	0.436	0.565	Q9I8U9.pdb.gz	Q9I8U9_DANRE Fast skeletal muscle troponin T OS=Danio rerio OX=7955 GN=tnnt PE=1 SV=1
11	PDB:7utiY	0.225	0.799	1.764E-7	74	0.245	0.986	7utiY.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
12	PDB:7utlV	0.234	0.395	1.860	170	0.060	0.106	7utlV.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
13	PDB:7ajtUN	0.074	0.145	4.530	147	0.050	0.102	7ajtUN.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:6cp37	0.113	0.192	7.613	171	0.060	0.105	6cp37.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.
15	PDB:6ltjI	0.163	0.091	8.199	551	0.040	0.022	6ltjI.pdb.gz	Structure of nucleosome-bound human BAF complex.
16	PDB:6t9lN	0.062	0.154	8.831	82	0.027	0.098	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P45379	0.0	575	298	1.000	1.000	TNNT2_HUMAN Troponin T, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNT2 PE=1 SV=3
2	P50752	9.92e-146	413	301	0.768	0.761	TNNT2_MOUSE Troponin T, cardiac muscle OS=Mus musculus OX=10090 GN=Tnnt2 PE=1 SV=2
3	P50753	5.15e-145	411	299	0.768	0.766	TNNT2_RAT Troponin T, cardiac muscle OS=Rattus norvegicus OX=10116 GN=Tnnt2 PE=1 SV=2
4	Q90Y46	8.65e-84	255	282	0.567	0.599	Q90Y46_DANRE Cardiac troponin T OS=Danio rerio OX=7955 GN=tnnt2 PE=1 SV=1
5	F1R0K6	1.57e-83	254	264	0.534	0.602	F1R0K6_DANRE Troponin T type 2a (cardiac) OS=Danio rerio OX=7955 GN=cTnT PE=1 SV=1
6	P09739	8.57e-83	252	259	0.487	0.560	TNNT3_RAT Troponin T, fast skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt3 PE=1 SV=2
7	P45378	7.45e-82	249	269	0.490	0.543	TNNT3_HUMAN Troponin T, fast skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT3 PE=1 SV=3
8	O88346	2.27e-81	248	262	0.520	0.592	TNNT1_MOUSE Troponin T, slow skeletal muscle OS=Mus musculus OX=10090 GN=Tnnt1 PE=2 SV=3
9	Q8AVB1	5.31e-81	248	290	0.477	0.490	Q8AVB1_DANRE Slow troponin T OS=Danio rerio OX=7955 GN=tnnt1 PE=1 SV=1
10	Q4QRC7	1.12e-76	236	241	0.443	0.548	Q4QRC7_DANRE Troponin T2d, cardiac OS=Danio rerio OX=7955 GN=zgc:114184 PE=1 SV=1
11	Q7TNB2	3.05e-75	233	261	0.547	0.625	TNNT1_RAT Troponin T, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnnt1 PE=1 SV=3
12	Q7ZZW4	1.26e-73	227	232	0.466	0.599	Q7ZZW4_DANRE Fast muscle troponin T isoform TnnT3b OS=Danio rerio OX=7955 GN=b44 PE=1 SV=1
13	A8WGA6	7.67e-72	224	284	0.460	0.482	A8WGA6_DANRE Tnnt3b protein OS=Danio rerio OX=7955 GN=b44 PE=1 SV=1
14	P13805	1.32e-65	208	278	0.547	0.586	TNNT1_HUMAN Troponin T, slow skeletal muscle OS=Homo sapiens OX=9606 GN=TNNT1 PE=1 SV=4
15	Q9I8U9	6.14e-62	197	230	0.443	0.574	Q9I8U9_DANRE Fast skeletal muscle troponin T OS=Danio rerio OX=7955 GN=tnnt PE=1 SV=1
16	A0A060XT52	3.65e-45	155	243	0.433	0.531	A0A060XT52_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00050634001 PE=3 SV=1
17	A0A060WB67	1.25e-42	150	305	0.426	0.416	A0A060WB67_ONCMY Troponin T type 3a (skeletal, fast) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065892001 PE=3 SV=1
18	P19351	2.46e-11	65.9	397	0.248	0.186	TNNT_DROME Troponin T, skeletal muscle OS=Drosophila melanogaster OX=7227 GN=up PE=1 SV=3
19	F4J0L7	2.37e-04	45.1	2156	0.141	0.019	F4J0L7_ARATH Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At3g50370 PE=1 SV=1
20	O44572	0.022	37.7	194	0.138	0.211	TNNI4_CAEEL Troponin I 4 OS=Caenorhabditis elegans OX=6239 GN=tni-4 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00992 Troponin	1.7e-30	117.4	Troponin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000236918

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232975	0.999	Troponin C, slow skeletal and cardiac muscles
2	9606.ENSP00000341838	0.999	Troponin I, cardiac muscle
3	9606.ENSP00000351022	0.997	Tropomyosin alpha-1 chain
4	9606.ENSP00000371331	0.986	Troponin I, fast skeletal muscle
5	9606.ENSP00000354488	0.983	Troponin I, slow skeletal muscle
6	9606.ENSP00000361636	0.978	Troponin C, skeletal muscle
7	9606.ENSP00000290378	0.973	Actin, alpha cardiac muscle 1
8	9606.ENSP00000386041	0.973	Myosin-6
9	9606.ENSP00000442795	0.967	Myosin-binding protein C, cardiac-type
10	9606.ENSP00000223364	0.965	Myosin regulatory light chain 2, atrial isoform
11	9606.ENSP00000467176	0.949	Troponin T, slow skeletal muscle
12	9606.ENSP00000228841	0.947	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
13	9606.ENSP00000443495	0.947	Alpha-actinin-2
14	9606.ENSP00000345230	0.945	Tropomyosin alpha-4 chain
15	9606.ENSP00000379210	0.943	Myosin light chain 3
16	9606.ENSP00000357516	0.937	Tropomyosin alpha-3 chain
17	9606.ENSP00000367542	0.932	Tropomyosin beta chain
18	9606.ENSP00000467141	0.930	Titin
19	9606.ENSP00000347507	0.929	Myosin-7
20	9606.ENSP00000307280	0.919	Myosin light chain 1/3, skeletal muscle isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005523	0.997	tropomyosin binding
GO:0031013	0.984	troponin I binding
GO:0003779	0.981	actin binding
GO:0042802	0.968	identical protein binding
GO:0030172	0.945	troponin C binding
GO:0000146	0.908	microfilament motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0050789	0.995	regulation of biological process
GO:0009987	0.991	cellular process
GO:0044057	0.976	regulation of system process
GO:0003008	0.975	system process
GO:0048513	0.968	animal organ development
GO:0003012	0.968	muscle system process
GO:0006936	0.958	muscle contraction
GO:0055008	0.955	cardiac muscle tissue morphogenesis
GO:0016043	0.953	cellular component organization
GO:0003229	0.947	ventricular cardiac muscle tissue development
GO:0003208	0.947	cardiac ventricle morphogenesis
GO:0006941	0.946	striated muscle contraction
GO:0055010	0.940	ventricular cardiac muscle tissue morphogenesis
GO:0030029	0.938	actin filament-based process
GO:1903522	0.937	regulation of blood circulation
GO:0008016	0.908	regulation of heart contraction
GO:0006937	0.897	regulation of muscle contraction
GO:0050794	0.891	regulation of cellular process
GO:0060047	0.876	heart contraction
GO:0006996	0.854	organelle organization
GO:0050896	0.833	response to stimulus
GO:0060048	0.790	cardiac muscle contraction
GO:0030036	0.781	actin cytoskeleton organization
GO:0097435	0.753	supramolecular fiber organization
GO:0048869	0.724	cellular developmental process
GO:0042692	0.565	muscle cell differentiation
GO:0051146	0.555	striated muscle cell differentiation
GO:0048646	0.497	anatomical structure formation involved in morphogenesis
GO:0048468	0.440	cell development
GO:0030239	0.431	myofibril assembly
GO:0045214	0.399	sarcomere organization
GO:0065008	0.316	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005861	0.998	troponin complex
GO:0005829	0.973	cytosol
GO:0043231	0.539	intracellular membrane-bounded organelle
GO:1990584	0.389	cardiac Troponin complex
GO:0097512	0.370	cardiac myofibril

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.908	myosin ATPase.

[back to server]