StarFunc result for job id P45381

User Input

>input (313 residues)
MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKK
CTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS
NMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG
PQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIA
AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK
LTLNAKSIRCCLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P45381	1.000	1.000	1.017E-72	313	1.000	1.000	P45381.pdb.gz	ACY2_HUMAN Aspartoacylase OS=Homo sapiens OX=9606 GN=ASPA PE=1 SV=1
2	AFDB:Q8R3P0	0.987	0.990	7.263E-64	312	0.863	0.865	Q8R3P0.pdb.gz	ACY2_MOUSE Aspartoacylase OS=Mus musculus OX=10090 GN=Aspa PE=1 SV=2
3	PDB:4mriB	0.963	0.995	6.264E-63	303	0.965	0.997	4mriB.pdb.gz	Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
4	PDB:2gu2A	0.962	0.980	2.103E-60	307	0.843	0.860	2gu2A.pdb.gz	Structure of aspartoacylase, the brain enzyme impaired in Canavan disease.
5	AFDB:Q96HD9	0.945	0.928	2.415E-46	319	0.441	0.433	Q96HD9.pdb.gz	ACY3_HUMAN N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) OS=Homo sapiens OX=9606 GN=ACY3 PE=1 SV=1
6	AFDB:Q91XE4	0.939	0.924	6.197E-45	318	0.422	0.415	Q91XE4.pdb.gz	ACY3_MOUSE N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) OS=Mus musculus OX=10090 GN=Acy3 PE=1 SV=1
7	PDB:3nh5A	0.931	0.952	7.716E-44	306	0.412	0.422	3nh5A.pdb.gz	Structures of aminoacylase 3 in complex with acetylated substrates.
8	AFDB:P76215	0.587	0.573	2.772E-12	322	0.160	0.155	P76215.pdb.gz	ASTE_ECOLI Succinylglutamate desuccinylase OS=Escherichia coli (strain K12) OX=83333 GN=astE PE=1 SV=1
9	AFDB:O50177	0.608	0.579	3.018E-11	332	0.147	0.139	O50177.pdb.gz	ASTE_PSEAE Succinylglutamate desuccinylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=astE PE=3 SV=1
10	PDB:1yw6A	0.562	0.557	9.289E-8	316	0.153	0.152	1yw6A.pdb.gz
11	AFDB:E1V7W0	0.604	0.559	2.163E-7	342	0.144	0.132	E1V7W0.pdb.gz	DOEB_HALED N-alpha-acetyl-L-2,4-diaminobutyric acid deacetylase OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) OX=768066 GN=doeB PE=1 SV=1
12	AFDB:Q09LZ8	0.431	0.271	2.504E-6	540	0.144	0.083	Q09LZ8.pdb.gz	CBPC6_MOUSE Cytosolic carboxypeptidase 6 OS=Mus musculus OX=10090 GN=Agbl4 PE=1 SV=1
13	AFDB:Q8CDP0	0.433	0.154	6.273E-6	1006	0.125	0.039	Q8CDP0.pdb.gz	CBPC3_MOUSE Cytosolic carboxypeptidase 3 OS=Mus musculus OX=10090 GN=Agbl3 PE=1 SV=1
14	AFDB:Q5U5Z8	0.437	0.170	6.669E-6	902	0.109	0.038	Q5U5Z8.pdb.gz	CBPC2_HUMAN Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=AGBL2 PE=1 SV=2
15	PDB:2nsmA	0.338	0.287	2.759E-5	390	0.157	0.126	2nsmA.pdb.gz
16	PDB:1uwyA	0.399	0.328	1.355E-4	393	0.131	0.104	1uwyA.pdb.gz	Crystal Structure of Human Carboxypeptidase M, a Membrane-Bound Enzyme that Regulates Peptide Hormone Activity
17	PDB:4axvA	0.360	0.446	1.532E-4	241	0.109	0.141	4axvA.pdb.gz	Mpaa is a Murein-Tripeptide-Specific Zinc Carboxypeptidase that Functions as Part of a Catabolic Pathway for Peptidoglycan Derived Peptides in Gamma-Proteobacteria.
18	PDB:1ayeA	0.372	0.303	1.628E-4	401	0.115	0.090	1ayeA.pdb.gz	The three-dimensional structure of human procarboxypeptidase A2. Deciphering the basis of the inhibition, activation and intrinsic activity of the zymogen.
19	PDB:4p10A	0.402	0.326	1.957E-4	402	0.102	0.080	4p10A.pdb.gz	Design and synthesis of conformationally restricted inhibitors of active thrombin activatable fibrinolysis inhibitor (TAFIa).
20	PDB:5mrvA	0.408	0.415	3.395E-4	307	0.102	0.104	5mrvA.pdb.gz	Crystal structure and mechanism of human carboxypeptidase O: Insights into its specific activity for acidic residues.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P45381	0.0	654	313	1.000	1.000	ACY2_HUMAN Aspartoacylase OS=Homo sapiens OX=9606 GN=ASPA PE=1 SV=1
2	Q6FH48	0.0	654	313	1.000	1.000	Q6FH48_HUMAN ASPA protein (Fragment) OS=Homo sapiens OX=9606 GN=ASPA PE=2 SV=1
3	Q8R3P0	0.0	581	312	0.863	0.865	ACY2_MOUSE Aspartoacylase OS=Mus musculus OX=10090 GN=Aspa PE=1 SV=2
4	Q9R1T5	0.0	585	312	0.869	0.872	ACY2_RAT Aspartoacylase OS=Rattus norvegicus OX=10116 GN=Aspa PE=1 SV=2
5	Q96HD9	9.25e-101	300	319	0.441	0.433	ACY3_HUMAN N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) OS=Homo sapiens OX=9606 GN=ACY3 PE=1 SV=1
6	Q91XE4	6.65e-96	288	318	0.425	0.418	ACY3_MOUSE N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) OS=Mus musculus OX=10090 GN=Acy3 PE=1 SV=1
7	I3L0T3	1.05e-51	166	78	0.249	1.000	I3L0T3_HUMAN Aspartoacylase (Fragment) OS=Homo sapiens OX=9606 GN=ASPA PE=1 SV=8
8	O50177	0.079	36.6	332	0.073	0.069	ASTE_PSEAE Succinylglutamate desuccinylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=astE PE=3 SV=1
9	P15393	1.4	33.1	499	0.064	0.040	C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11b1 PE=1 SV=1
10	Q8K3K1	5.8	31.2	5125	0.083	0.005	USH2A_RAT Usherin OS=Rattus norvegicus OX=10116 GN=Ush2a PE=1 SV=2
11	A0A1D8PH11	6.5	31.2	1914	0.032	0.005	A0A1D8PH11_CANAL Dck1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCK1 PE=3 SV=1
12	Q13487	6.9	30.8	334	0.067	0.063	SNPC2_HUMAN snRNA-activating protein complex subunit 2 OS=Homo sapiens OX=9606 GN=SNAPC2 PE=1 SV=1
13	Q3TR45	7.3	30.8	498	0.070	0.044	Q3TR45_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=2 SV=1
14	Q3TG86	7.5	30.8	501	0.070	0.044	Q3TG86_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=1 SV=1
15	Q3UQH5	7.7	30.8	501	0.070	0.044	Q3UQH5_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=2 SV=1
16	P76215	9.7	30.0	322	0.099	0.096	ASTE_ECOLI Succinylglutamate desuccinylase OS=Escherichia coli (strain K12) OX=83333 GN=astE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04952 AstE_AspA	1.9e-72	255.5	Succinylglutamate desuccinylase / Aspartoacylase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256999	0.954	Glutamate carboxypeptidase 2
2	9606.ENSP00000350136	0.935	Beta-citrylglutamate synthase B
3	9606.ENSP00000414330	0.935	N-acetylaspartylglutamate synthase A
4	9606.ENSP00000413064	0.928	N-acetylaspartate synthetase
5	9606.ENSP00000384296	0.922	Aminoacylase-1
6	9606.ENSP00000359539	0.917	Aspartate aminotransferase, cytoplasmic
7	9606.ENSP00000245206	0.912	Aspartate aminotransferase, mitochondrial
8	9606.ENSP00000175506	0.909	Asparagine synthetase
9	9606.ENSP00000361471	0.907	Argininosuccinate synthase
10	9606.ENSP00000472474	0.903	L-amino-acid oxidase
11	9606.ENSP00000303077	0.902	Putative aspartate aminotransferase, cytoplasmic 2
12	9606.ENSP00000400057	0.902	Isoaspartyl peptidase/L-asparaginase
13	9606.ENSP00000264705	0.900	CAD protein
14	9606.ENSP00000333019	0.900	Adenylosuccinate synthetase isozyme 1
15	9606.ENSP00000355493	0.900	Adenylosuccinate synthetase isozyme 2
16	9606.ENSP00000307900	0.846	Glutamine synthetase
17	9606.ENSP00000365437	0.822	Glutamate decarboxylase 2
18	9606.ENSP00000364490	0.815	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
19	9606.ENSP00000350928	0.813	Glutamate decarboxylase 1
20	9606.ENSP00000277865	0.808	Glutamate dehydrogenase 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0016811	1.000	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0004046	0.978	aminoacylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0044281	0.984	small molecule metabolic process
GO:0044238	0.980	primary metabolic process
GO:0019752	0.972	carboxylic acid metabolic process
GO:1901564	0.934	organonitrogen compound metabolic process
GO:1901605	0.917	alpha-amino acid metabolic process
GO:0046395	0.838	carboxylic acid catabolic process
GO:0043648	0.826	dicarboxylic acid metabolic process
GO:1901606	0.700	alpha-amino acid catabolic process
GO:0009066	0.627	aspartate family amino acid metabolic process
GO:0009063	0.538	amino acid catabolic process
GO:0043649	0.337	dicarboxylic acid catabolic process
GO:0065007	0.321	biological regulation
GO:0050789	0.309	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.836	membrane-bounded organelle
GO:0043231	0.805	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	1.000	In linear amides.
RHEA:15565	0.978	an N-acyl-L-amino acid + H2O = a carboxylate + an L-alpha-amino acid
EC:3.5.1.14	0.978	N-acyl-aliphatic-L-amino acid amidohydrolase.

[back to server]