StarFunc result for job id P45844

User Input

>input (678 residues)
MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNL
TEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPS
GAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMV
SAHLKLQEKDEGRREMVKEILTALGLLSCANTRTGSLSGGQRKRLAIALELVNNPPVMFF
DEPTSGLDSASCFQVVSLMKGLAQGGRSIICTIHQPSAKLFELFDQLYVLSQGQCVYRGK
VCNLVPYLRDLGLNCPTYHNPADFVMEVASGEYGDQNSRLVRAVREGMCDSDHKRDLGGD
AEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCLTQFCILFKRTFLSIMRDS
VLTHLRITSHIGIGLLIGLLYLGIGNEAKKVLSNSGFLFFSMLFLMFAALMPTVLTFPLE
MGVFLREHLNYWYSLKAYYLAKTMADVPFQIMFPVAYCSIVYWMTSQPSDAVRFVLFAAL
GTMTSLVAQSLGLLIGAASTSLQVATFVGPVTAIPVLLFSGFFVSFDTIPTYLQWMSYIS
YVRYGFEGVILSIYGLDREDLHCDIDETCHFQKSEAILRELDVENAKLYLDFIVLGIFFI
SLRLIAYFVLRYKIRAER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P45844	1.000	1.000	2.893E-96	678	1.000	1.000	P45844.pdb.gz	ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens OX=9606 GN=ABCG1 PE=1 SV=3
2	AFDB:A4QNW0	0.923	0.930	2.186E-82	673	0.845	0.851	A4QNW0.pdb.gz	A4QNW0_DANRE ATP-binding cassette sub-family G member 1 OS=Danio rerio OX=7955 GN=abcg1 PE=2 SV=1
3	AFDB:Q91WA9	0.866	0.908	7.973E-72	646	0.671	0.704	Q91WA9.pdb.gz	ABCG4_MOUSE ATP-binding cassette subfamily G member 4 OS=Mus musculus OX=10090 GN=Abcg4 PE=1 SV=2
4	PDB:7r8eA	0.730	0.890	6.831E-61	548	0.807	0.998	7r8eA.pdb.gz	Molecular basis of cholesterol efflux via ABCG subfamily transporters.
5	AFDB:Q9VQY4	0.831	0.678	5.312E-60	832	0.538	0.439	Q9VQY4.pdb.gz	Q9VQY4_DROME ABC transporter expressed in trachea, isoform A OS=Drosophila melanogaster OX=7227 GN=Atet PE=3 SV=1
6	AFDB:Q8T9E6	0.805	0.715	1.449E-49	766	0.381	0.337	Q8T9E6.pdb.gz	Q8T9E6_DROME SD03967p OS=Drosophila melanogaster OX=7227 GN=ABCG1 PE=2 SV=1
7	AFDB:Q0E8U2	0.778	0.861	7.632E-47	609	0.339	0.378	Q0E8U2.pdb.gz	Q0E8U2_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9664 PE=3 SV=1
8	AFDB:P10090	0.774	0.765	3.946E-41	687	0.305	0.301	P10090.pdb.gz	WHITE_DROME Protein white OS=Drosophila melanogaster OX=7227 GN=w PE=1 SV=2
9	AFDB:Q38AM7	0.778	0.815	4.856E-41	646	0.280	0.294	Q38AM7.pdb.gz	Q38AM7_TRYB2 ATP-binding cassette protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3320 PE=4 SV=1
10	AFDB:Q9C6W5	0.774	0.808	7.514E-40	648	0.273	0.285	Q9C6W5.pdb.gz	AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana OX=3702 GN=ABCG14 PE=1 SV=1
11	AFDB:Q19585	0.776	0.758	9.639E-40	695	0.280	0.273	Q19585.pdb.gz	Q19585_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=wht-5 PE=1 SV=1
12	PDB:6hbuA	0.683	0.781	3.818E-34	584	0.246	0.286	6hbuA.pdb.gz	Cryo-EM structures of a human ABCG2 mutant trapped in ATP-bound and substrate-bound states.
13	PDB:7r89B	0.699	0.887	5.676E-31	529	0.212	0.272	7r89B.pdb.gz	Molecular basis of cholesterol efflux via ABCG subfamily transporters.
14	PDB:7jr7B	0.727	0.845	1.249E-30	579	0.224	0.263	7jr7B.pdb.gz
15	PDB:8cubC	0.732	0.839	1.506E-29	588	0.218	0.252	8cubC.pdb.gz	Structural Analysis of Cholesterol Binding and Sterol Selectivity by ABCG5/G8.
16	PDB:7p04A	0.735	0.382	2.285E-27	1353	0.220	0.110	7p04A.pdb.gz	Structure and efflux mechanism of the yeast pleiotropic drug resistance transporter Pdr5.
17	PDB:7p03A	0.718	0.382	2.334E-26	1333	0.226	0.115	7p03A.pdb.gz
18	PDB:5do7B	0.697	0.833	5.943E-25	562	0.209	0.253	5do7B.pdb.gz
19	PDB:7p06A	0.677	0.367	1.748E-24	1350	0.199	0.100	7p06A.pdb.gz	Structure and efflux mechanism of the yeast pleiotropic drug resistance transporter Pdr5.
20	PDB:6mbnA	0.313	0.816	7.528E-14	241	0.081	0.228	6mbnA.pdb.gz	Combining Mutations That Inhibit Two Distinct Steps of the ATP Hydrolysis Cycle Restores Wild-Type Function in the Lipopolysaccharide Transporter and Shows that ATP Binding Triggers Transport.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K987	0.0	1272	664	0.938	0.958	A0A0G2K987_RAT ATP binding cassette subfamily G member 1 OS=Rattus norvegicus OX=10116 GN=Abcg1 PE=3 SV=2
2	A4QNW0	0.0	1149	673	0.847	0.853	A4QNW0_DANRE ATP-binding cassette sub-family G member 1 OS=Danio rerio OX=7955 GN=abcg1 PE=2 SV=1
3	G3V642	0.0	1336	666	0.953	0.970	G3V642_RAT ATP binding cassette subfamily G member 1 OS=Rattus norvegicus OX=10116 GN=Abcg1 PE=3 SV=3
4	P45844	0.0	1402	678	1.000	1.000	ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens OX=9606 GN=ABCG1 PE=1 SV=3
5	Q64343	0.0	1335	666	0.951	0.968	ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus OX=10090 GN=Abcg1 PE=1 SV=1
6	Q91WA9	0.0	949	646	0.674	0.707	ABCG4_MOUSE ATP-binding cassette subfamily G member 4 OS=Mus musculus OX=10090 GN=Abcg4 PE=1 SV=2
7	Q9EPG9	0.0	1335	666	0.951	0.968	Q9EPG9_RAT ABC transporter, white homologue OS=Rattus norvegicus OX=10116 GN=Abcg1 PE=2 SV=1
8	Q9H172	0.0	934	646	0.673	0.706	ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens OX=9606 GN=ABCG4 PE=1 SV=2
9	Q8T9E6	1.11e-140	431	766	0.392	0.347	Q8T9E6_DROME SD03967p OS=Drosophila melanogaster OX=7227 GN=ABCG1 PE=2 SV=1
10	Q0E8U2	2.24e-126	389	609	0.335	0.373	Q0E8U2_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9664 PE=3 SV=1
11	M9NEQ1	2.67e-126	389	608	0.335	0.373	M9NEQ1_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9664 PE=3 SV=1
12	Q9VQY4	3.90e-123	387	832	0.294	0.239	Q9VQY4_DROME ABC transporter expressed in trachea, isoform A OS=Drosophila melanogaster OX=7227 GN=Atet PE=3 SV=1
13	P10090	1.11e-106	340	687	0.291	0.287	WHITE_DROME Protein white OS=Drosophila melanogaster OX=7227 GN=w PE=1 SV=2
14	Q9C6W5	6.92e-92	300	648	0.289	0.302	AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana OX=3702 GN=ABCG14 PE=1 SV=1
15	Q11180	1.14e-91	300	671	0.261	0.264	WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans OX=6239 GN=wht-1 PE=2 SV=3
16	Q19585	2.34e-84	281	695	0.298	0.291	Q19585_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=wht-5 PE=1 SV=1
17	Q9LK50	4.95e-84	280	685	0.267	0.264	AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana OX=3702 GN=ABCG26 PE=2 SV=2
18	Q9ZU35	2.33e-83	280	725	0.260	0.243	AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana OX=3702 GN=ABCG7 PE=2 SV=1
19	Q9UNQ0	1.22e-80	271	655	0.243	0.252	ABCG2_HUMAN Broad substrate specificity ATP-binding cassette transporter ABCG2 OS=Homo sapiens OX=9606 GN=ABCG2 PE=1 SV=3
20	Q2Q447	3.45e-80	269	643	0.270	0.285	Q2Q447_DANRE ATP-binding cassette sub-family G member 2 OS=Danio rerio OX=7955 GN=wu:fd59c01 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	80	13.4	AAA domain
2	PF13191 AAA_16	52	15.6	AAA ATPase domain
3	PF13238 AAA_18	1.5e+02	14.3	AAA domain
4	PF13304 AAA_21	0.037	25.4	AAA domain, putative AbiEii toxin, Type IV TA system
5	PF13401 AAA_22	2.3e+02	13.5	AAA domain
6	PF13476 AAA_23	1.4e+02	14.4	AAA domain
7	PF13481 AAA_25	7.4e+02	11.1	AAA domain
8	PF13521 AAA_28	2.1e+02	13.6	AAA domain
9	PF13555 AAA_29	27	15.9	P-loop containing region of AAA domain
10	PF13604 AAA_30	3.1e+02	12.5	AAA domain
11	PF01061 ABC2_membrane	4.6e-44	161.9	ABC-2 type transporter
12	PF19055 ABC2_membrane_7	1e-10	52.7	ABC-2 type transporter
13	PF00005 ABC_tran	1.3e-24	98.7	ABC transporter
14	PF02492 cobW	88	14.1	CobW/HypB/UreG, nucleotide-binding domain
15	PF02224 Cytidylate_kin	6.4e+02	11.5	Cytidylate kinase
16	PF07274 DUF1440	6.3e+02	12.0	Protein of unknown function (DUF1440)
17	PF01926 MMR_HSR1	41	15.7	50S ribosome-binding GTPase
18	PF03215 Rad17	2.9e+02	12.8	Rad17 P-loop domain
19	PF03193 RsgA_GTPase	0.8	21.1	RsgA GTPase
20	PF02463 SMC_N	0.0078	27.2	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354995

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000477707	0.983	Oxysterols receptor LXR-alpha
2	9606.ENSP00000253727	0.974	Oxysterols receptor LXR-beta
3	9606.ENSP00000419692	0.948	Retinoic acid receptor RXR-alpha
4	9606.ENSP00000370104	0.947	G protein pathway suppressor 2
5	9606.ENSP00000236850	0.932	Apolipoprotein A-I
6	9606.ENSP00000363817	0.928	Retinoic acid receptor RXR-beta
7	9606.ENSP00000252486	0.921	Apolipoprotein E
8	9606.ENSP00000361473	0.906	Lysine-specific demethylase 4A
9	9606.ENSP00000383042	0.904	Lysine-specific histone demethylase 1A
10	9606.ENSP00000297792	0.902	Lysine-specific histone demethylase 1B
11	9606.ENSP00000386660	0.900	Lysine-specific demethylase 3A
12	9606.ENSP00000261693	0.878	Scavenger receptor class B member 1
13	9606.ENSP00000200676	0.793	Cholesteryl ester transfer protein
14	9606.ENSP00000348069	0.750	Sterol regulatory element-binding protein 1
15	9606.ENSP00000354476	0.746	Sterol regulatory element-binding protein 2
16	9606.ENSP00000339191	0.740	Caveolin-1
17	9606.ENSP00000454071	0.716	Low-density lipoprotein receptor
18	9606.ENSP00000329403	0.713	Calmodulin regulator protein PCP4
19	9606.ENSP00000264005	0.712	Phosphatidylcholine-sterol acyltransferase
20	9606.ENSP00000233242	0.708	Apolipoprotein B-100

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140359	0.997	ABC-type transporter activity
GO:0042803	0.996	protein homodimerization activity
GO:0120020	0.995	cholesterol transfer activity
GO:1901618	0.987	organic hydroxy compound transmembrane transporter activity
GO:0046982	0.987	protein heterodimerization activity
GO:0097159	0.981	organic cyclic compound binding
GO:1901363	0.969	heterocyclic compound binding
GO:0036094	0.958	small molecule binding
GO:0043167	0.953	ion binding
GO:0043168	0.922	anion binding
GO:0097367	0.907	carbohydrate derivative binding
GO:0000166	0.896	nucleotide binding
GO:0032559	0.879	adenyl ribonucleotide binding
GO:0005524	0.864	ATP binding
GO:0008525	0.854	phosphatidylcholine transporter activity
GO:0140303	0.799	intramembrane lipid transporter activity
GO:0015485	0.700	cholesterol binding
GO:0019534	0.682	toxin transmembrane transporter activity
GO:0140326	0.674	ATPase-coupled intramembrane lipid transporter activity
GO:0003824	0.484	catalytic activity
GO:0034040	0.417	ATPase-coupled lipid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051049	0.990	regulation of transport
GO:0030301	0.987	cholesterol transport
GO:0050794	0.981	regulation of cellular process
GO:0048518	0.975	positive regulation of biological process
GO:0051050	0.971	positive regulation of transport
GO:0050708	0.822	regulation of protein secretion
GO:0009987	0.818	cellular process
GO:0051222	0.785	positive regulation of protein transport
GO:1903532	0.781	positive regulation of secretion by cell
GO:0090276	0.752	regulation of peptide hormone secretion
GO:0050714	0.742	positive regulation of protein secretion
GO:0050796	0.739	regulation of insulin secretion
GO:0035774	0.686	positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0008152	0.587	metabolic process
GO:0071704	0.554	organic substance metabolic process
GO:0032501	0.488	multicellular organismal process
GO:1905952	0.463	regulation of lipid localization
GO:0019222	0.416	regulation of metabolic process
GO:0051128	0.403	regulation of cellular component organization
GO:0080090	0.386	regulation of primary metabolic process
GO:0009893	0.371	positive regulation of metabolic process
GO:0044238	0.364	primary metabolic process
GO:0050896	0.362	response to stimulus
GO:0009889	0.341	regulation of biosynthetic process
GO:0048519	0.323	negative regulation of biological process
GO:0032368	0.310	regulation of lipid transport
GO:0032374	0.301	regulation of cholesterol transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.976	endomembrane system
GO:0031982	0.910	vesicle
GO:0031090	0.849	organelle membrane
GO:0031410	0.823	cytoplasmic vesicle
GO:0098588	0.627	bounding membrane of organelle
GO:0009986	0.428	cell surface
GO:0098552	0.421	side of membrane
GO:0009897	0.414	external side of plasma membrane
GO:0005768	0.397	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.998	Translocases.
RHEA:39747	0.996	cholesterol(in) = cholesterol(out)
EC:7.6.2.1	0.674	P-type phospholipid transporter.

[back to server]