StarFunc result for job id P45954

User Input

>input (432 residues)
MEGLAVRLLRGSRLLRRNFLTCLSSWKIPPHVSKSSQSEALLNITNNGIHFAPLQTFTDE
EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLS
TVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAG
AGSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRD
TPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQ
MLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLEAG
KPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQ
LNTIAKHIDAEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z3P9	0.893	0.893	2.712E-66	432	1.000	1.000	A0A0S2Z3P9.pdb.gz	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
2	AFDB:P70584	0.892	0.892	2.983E-60	432	0.836	0.836	P70584.pdb.gz	ACDSB_RAT Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadsb PE=1 SV=1
3	AFDB:Q95U46	0.879	0.917	1.756E-47	414	0.546	0.570	Q95U46.pdb.gz	Q95U46_DROME GH07925p OS=Drosophila melanogaster OX=7227 GN=CG3902 PE=2 SV=1
4	AFDB:C8VQF1	0.877	0.863	3.965E-46	439	0.493	0.485	C8VQF1.pdb.gz	C8VQF1_EMENI Acyl-CoA dehydrogenase, putative (AFU_orthologue AFUA_1G14850) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00824 PE=3 SV=1
5	AFDB:H2KZG6	0.882	0.892	3.531E-45	427	0.500	0.506	H2KZG6.pdb.gz	H2KZG6_CAEEL Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acdh-1 PE=1 SV=1
6	AFDB:E5KSD5	0.864	0.906	5.770E-38	412	0.361	0.379	E5KSD5.pdb.gz	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
7	PDB:1jqiA	0.861	0.968	7.440E-38	384	0.352	0.396	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
8	AFDB:Q3ZBF6	0.856	0.896	1.215E-37	412	0.359	0.376	Q3ZBF6.pdb.gz	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
9	AFDB:G3KIM8	0.855	0.937	8.778E-36	394	0.356	0.391	G3KIM8.pdb.gz	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
10	AFDB:P9WQG1	0.851	0.943	9.634E-36	389	0.336	0.373	P9WQG1.pdb.gz	ACDP_MYCTU Probable acyl-CoA dehydrogenase FadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE25 PE=1 SV=1
11	AFDB:G5EEH6	0.860	0.886	2.332E-35	419	0.322	0.332	G5EEH6.pdb.gz	G5EEH6_CAEEL Isovaleryl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ivd-1 PE=1 SV=1
12	PDB:1ivhA	0.851	0.949	6.186E-34	387	0.299	0.333	1ivhA.pdb.gz	Structure of human isovaleryl-CoA dehydrogenase at 2.6 A resolution: structural basis for substrate specificity,.
13	PDB:6fahC	0.844	0.960	1.009E-32	379	0.338	0.385	6fahC.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
14	PDB:1rx0A	0.847	0.951	1.057E-32	384	0.312	0.352	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
15	PDB:2a1tC	0.859	0.955	1.570E-31	388	0.331	0.369	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
16	PDB:2ix6A	0.824	0.855	1.399E-28	416	0.259	0.269	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
17	PDB:7s7gA	0.805	0.614	3.893E-28	571	0.287	0.217	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
18	PDB:2r0mA	0.829	0.917	3.987E-27	390	0.248	0.274	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.
19	PDB:6af6A	0.833	0.937	1.084E-25	383	0.211	0.238	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
20	PDB:4xvxB	0.751	0.862	7.664E-21	373	0.169	0.196	4xvxB.pdb.gz	A covalent adduct of MbtN, an acyl-ACP dehydrogenase from Mycobacterium tuberculosis, reveals an unusual acyl-binding pocket.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3P9	0.0	897	432	1.000	1.000	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
2	P45954	0.0	897	432	1.000	1.000	ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADSB PE=1 SV=1
3	P70584	0.0	759	432	0.833	0.833	ACDSB_RAT Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadsb PE=1 SV=1
4	Q95U46	0.0	516	414	0.546	0.570	Q95U46_DROME GH07925p OS=Drosophila melanogaster OX=7227 GN=CG3902 PE=2 SV=1
5	Q9DBL1	0.0	753	432	0.824	0.824	ACDSB_MOUSE Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadsb PE=1 SV=1
6	Q9VVU1	0.0	517	414	0.546	0.570	Q9VVU1_DROME FI09602p OS=Drosophila melanogaster OX=7227 GN=GH07925p PE=1 SV=1
7	H2KZG6	1.12e-164	471	427	0.495	0.501	H2KZG6_CAEEL Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acdh-1 PE=1 SV=1
8	C8VQF1	2.88e-150	435	439	0.493	0.485	C8VQF1_EMENI Acyl-CoA dehydrogenase, putative (AFU_orthologue AFUA_1G14850) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00824 PE=3 SV=1
9	Q07417	3.96e-96	296	412	0.350	0.367	ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acads PE=1 SV=2
10	P15651	4.09e-96	296	412	0.352	0.369	ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acads PE=1 SV=2
11	E5KSD5	1.22e-95	295	412	0.356	0.374	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
12	P16219	1.22e-95	295	412	0.356	0.374	ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1
13	G3KIM8	2.88e-93	288	394	0.359	0.393	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
14	P9WQG1	1.74e-92	286	389	0.340	0.378	ACDP_MYCTU Probable acyl-CoA dehydrogenase FadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE25 PE=1 SV=1
15	H6LGM6	2.94e-92	285	379	0.340	0.388	CARC_ACEWD Caffeyl-CoA reductase-Etf complex subunit CarC OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) OX=931626 GN=carC PE=1 SV=1
16	Q3ZBF6	7.69e-92	285	412	0.352	0.369	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
17	Q9I296	1.48e-83	263	387	0.310	0.346	Q9I296_PSEAE Isovaleryl-CoA dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuA PE=3 SV=1
18	P12007	3.77e-82	261	424	0.338	0.344	IVD_RAT Isovaleryl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ivd PE=1 SV=2
19	Q9JHI5	1.54e-80	256	424	0.333	0.340	IVD_MOUSE Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ivd PE=1 SV=1
20	Q9FS88	3.11e-80	255	412	0.333	0.350	MBCD_SOLTU 2-methylacyl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum OX=4113 GN=2MBCD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00441 Acyl-CoA_dh_1	1.2e-46	170.1	Acyl-CoA dehydrogenase, C-terminal domain
2	PF08028 Acyl-CoA_dh_2	7.1e-24	96.0	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	7.5e-22	88.6	Acyl-CoA dehydrogenase, middle domain
4	PF02771 Acyl-CoA_dh_N	5e-26	102.9	Acyl-CoA dehydrogenase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357873

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357535	0.983	Enoyl-CoA hydratase, mitochondrial
2	9606.ENSP00000285093	0.982	3-ketoacyl-CoA thiolase, mitochondrial
3	9606.ENSP00000333664	0.981	3-ketoacyl-CoA thiolase, peroxisomal
4	9606.ENSP00000325136	0.972	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
5	9606.ENSP00000265838	0.969	Acetyl-CoA acetyltransferase, mitochondrial
6	9606.ENSP00000231887	0.966	Peroxisomal bifunctional enzyme
7	9606.ENSP00000370023	0.966	Trifunctional enzyme subunit alpha, mitochondrial
8	9606.ENSP00000356015	0.965	Acetyl-CoA acetyltransferase, cytosolic
9	9606.ENSP00000222214	0.946	Glutaryl-CoA dehydrogenase, mitochondrial
10	9606.ENSP00000318351	0.944	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
11	9606.ENSP00000269980	0.942	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
12	9606.ENSP00000205402	0.919	Dihydrolipoyl dehydrogenase, mitochondrial
13	9606.ENSP00000359151	0.907	Dihydrolipoamide branched chain transacylase E2
14	9606.ENSP00000281182	0.900	Isobutyryl-CoA dehydrogenase, mitochondrial
15	9606.ENSP00000450436	0.899	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
16	9606.ENSP00000233710	0.886	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
17	9606.ENSP00000293217	0.868	Peroxisomal acyl-coenzyme A oxidase 1
18	9606.ENSP00000474560	0.854	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
19	9606.ENSP00000263702	0.850	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
20	9606.ENSP00000352706	0.833	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003995	1.000	acyl-CoA dehydrogenase activity
GO:0005488	0.997	binding
GO:0005515	0.896	protein binding
GO:1901363	0.526	heterocyclic compound binding
GO:0097159	0.503	organic cyclic compound binding
GO:0043168	0.472	anion binding
GO:0000166	0.441	nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0019752	0.997	carboxylic acid metabolic process
GO:0044248	0.988	cellular catabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:1901575	0.987	organic substance catabolic process
GO:1901564	0.982	organonitrogen compound metabolic process
GO:0032787	0.967	monocarboxylic acid metabolic process
GO:0016054	0.956	organic acid catabolic process
GO:0006631	0.956	fatty acid metabolic process
GO:0046395	0.951	carboxylic acid catabolic process
GO:0016042	0.748	lipid catabolic process
GO:0044242	0.719	cellular lipid catabolic process
GO:0019395	0.690	fatty acid oxidation
GO:0009062	0.585	fatty acid catabolic process
GO:0006635	0.512	fatty acid beta-oxidation
GO:0006520	0.441	amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0031974	0.979	membrane-enclosed lumen
GO:0070013	0.973	intracellular organelle lumen
GO:0005759	0.773	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	1.000	Acting on the CH-CH group of donors.

[back to server]