StarFunc result for job id P45973

User Input

>input (191 residues)
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCP
ELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG
LEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPED
AENKEKETAKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P45973	1.000	1.000	5.103E-33	191	1.000	1.000	P45973.pdb.gz	CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1
2	AFDB:O93480	0.368	0.380	1.345E-22	185	0.592	0.611	O93480.pdb.gz	O93480_CHICK Chromobox protein (CHCB1) OS=Gallus gallus OX=9031 PE=2 SV=1
3	AFDB:P23198	0.366	0.382	4.747E-21	183	0.597	0.623	P23198.pdb.gz	CBX3_MOUSE Chromobox protein homolog 3 OS=Mus musculus OX=10090 GN=Cbx3 PE=1 SV=2
4	AFDB:P05205	0.344	0.322	6.274E-18	206	0.445	0.413	P05205.pdb.gz	HP1_DROME Heterochromatin protein 1 OS=Drosophila melanogaster OX=7227 GN=Su(var)205 PE=1 SV=2
5	AFDB:Q95SE0	0.343	0.276	2.980E-16	240	0.429	0.342	Q95SE0.pdb.gz	Q95SE0_DROME GM01918p OS=Drosophila melanogaster OX=7227 GN=HP1b PE=1 SV=1
6	AFDB:G5EDE2	0.313	0.341	3.884E-14	175	0.314	0.343	G5EDE2.pdb.gz	CBXH2_CAEEL Chromobox protein homolog hpl-2 OS=Caenorhabditis elegans OX=6239 GN=hpl-2 PE=1 SV=1
7	AFDB:Q9VCU6	0.347	0.282	6.629E-14	237	0.304	0.245	Q9VCU6.pdb.gz	Q9VCU6_DROME Heterochromatin protein 1c OS=Drosophila melanogaster OX=7227 GN=HP1c PE=1 SV=1
8	AFDB:G5EET5	0.317	0.328	2.049E-13	184	0.298	0.310	G5EET5.pdb.gz	CBXH1_CAEEL Chromobox protein homolog hpl-1 OS=Caenorhabditis elegans OX=6239 GN=hpl-1 PE=1 SV=1
9	AFDB:Q54RN0	0.342	0.294	1.544E-12	225	0.314	0.267	Q54RN0.pdb.gz	Q54RN0_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=hcpA PE=4 SV=1
10	AFDB:Q9VHG0	0.305	0.332	9.731E-12	174	0.267	0.293	Q9VHG0.pdb.gz	Q9VHG0_DROME Heterochromatin protein 1e OS=Drosophila melanogaster OX=7227 GN=HP1e PE=2 SV=2
11	PDB:6g0lW	0.250	0.061	6.301E-4	878	0.152	0.033	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:6g0lM	0.239	0.058	8.999E-4	855	0.162	0.036	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
13	PDB:2iw3B	0.256	0.055	1.042E-1	980	0.068	0.013	2iw3B.pdb.gz	Structure of Eef3 and the Mechanism of Transfer RNA Release from the E-Site.
14	PDB:4iluA	0.152	0.170	3.417E-1	165	0.052	0.061	4iluA.pdb.gz
15	PDB:1ak5A	0.126	0.076	1.189	329	0.026	0.015	1ak5A.pdb.gz
16	PDB:1mjfA	0.152	0.110	1.508	271	0.026	0.018	1mjfA.pdb.gz
17	PDB:1yykA	0.134	0.120	1.508	221	0.063	0.054	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
18	PDB:7btbX	0.089	0.111	1.508	141	0.058	0.078	7btbX.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
19	PDB:2o06A	0.144	0.096	1.601	297	0.037	0.024	2o06A.pdb.gz	Structure and mechanism of spermidine synthases.
20	PDB:7nkyQ	0.133	0.074	1.699	404	0.094	0.045	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P45973	8.79e-140	389	191	1.000	1.000	CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1
2	V9HWG0	8.79e-140	389	191	1.000	1.000	V9HWG0_HUMAN Epididymis luminal protein 25 OS=Homo sapiens OX=9606 GN=HEL25 PE=1 SV=1
3	Q61686	3.48e-137	382	191	0.979	0.979	CBX5_MOUSE Chromobox protein homolog 5 OS=Mus musculus OX=10090 GN=Cbx5 PE=1 SV=1
4	P23198	2.38e-68	208	183	0.571	0.596	CBX3_MOUSE Chromobox protein homolog 3 OS=Mus musculus OX=10090 GN=Cbx3 PE=1 SV=2
5	Q13185	4.10e-68	207	183	0.571	0.596	CBX3_HUMAN Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4
6	Q5RJK5	4.10e-68	207	183	0.571	0.596	Q5RJK5_RAT Chromobox 3 OS=Rattus norvegicus OX=10116 GN=Cbx3 PE=1 SV=1
7	P83916	3.40e-65	200	185	0.534	0.551	CBX1_HUMAN Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1
8	P83917	3.40e-65	200	185	0.534	0.551	CBX1_MOUSE Chromobox protein homolog 1 OS=Mus musculus OX=10090 GN=Cbx1 PE=1 SV=1
9	O93480	7.14e-65	199	185	0.529	0.546	O93480_CHICK Chromobox protein (CHCB1) OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q9W396	5.13e-51	166	240	0.461	0.367	Q9W396_DROME FI06908p OS=Drosophila melanogaster OX=7227 GN=HP1b PE=1 SV=1
11	Q95SE0	5.41e-51	166	240	0.461	0.367	Q95SE0_DROME GM01918p OS=Drosophila melanogaster OX=7227 GN=HP1b PE=1 SV=1
12	P05205	7.96e-43	144	206	0.461	0.427	HP1_DROME Heterochromatin protein 1 OS=Drosophila melanogaster OX=7227 GN=Su(var)205 PE=1 SV=2
13	Q9VCU6	7.72e-28	106	237	0.293	0.236	Q9VCU6_DROME Heterochromatin protein 1c OS=Drosophila melanogaster OX=7227 GN=HP1c PE=1 SV=1
14	Q9VHG0	1.70e-23	93.6	174	0.272	0.299	Q9VHG0_DROME Heterochromatin protein 1e OS=Drosophila melanogaster OX=7227 GN=HP1e PE=2 SV=2
15	G5EDE2	2.27e-23	93.2	175	0.304	0.331	CBXH2_CAEEL Chromobox protein homolog hpl-2 OS=Caenorhabditis elegans OX=6239 GN=hpl-2 PE=1 SV=1
16	G5EET5	1.94e-22	91.3	184	0.293	0.304	CBXH1_CAEEL Chromobox protein homolog hpl-1 OS=Caenorhabditis elegans OX=6239 GN=hpl-1 PE=1 SV=1
17	Q9VR09	1.12e-18	79.3	106	0.178	0.321	Q9VR09_DROME Heterochromatin protein 6 OS=Drosophila melanogaster OX=7227 GN=HP6 PE=1 SV=1
18	Q14781	6.00e-12	65.5	532	0.141	0.051	CBX2_HUMAN Chromobox protein homolog 2 OS=Homo sapiens OX=9606 GN=CBX2 PE=1 SV=2
19	P30658	6.13e-12	65.5	519	0.141	0.052	CBX2_MOUSE Chromobox protein homolog 2 OS=Mus musculus OX=10090 GN=Cbx2 PE=1 SV=2
20	Q7JXA8	8.55e-12	65.1	418	0.147	0.067	RHINO_DROME Chromo domain-containing protein rhino OS=Drosophila melanogaster OX=7227 GN=rhi PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	4.7e-18	76.2	Chromo (CHRromatin Organisation MOdifier) domain
2	PF01393 Chromo_shadow	1.3e-25	100.6	Chromo shadow domain
3	PF14061 Mtf2_C	8.5	18.0	Polycomb-like MTF2 factor 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010607672.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010614697.1	0.982	Transcription intermediary factor 1-beta
2	885580.XP_010604673.1	0.962	Histone-lysine N-methyltransferase SUV39H1 isoform X1
3	885580.XP_010621402.1	0.932	Uncharacterized protein LOC104861624
4	885580.XP_010616712.1	0.929	Histone H3
5	885580.XP_010640861.1	0.914	Kinetochore-associated protein NSL1 homolog
6	885580.XP_010638316.1	0.900	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns
7	885580.XP_010633114.1	0.873	Chromatin assembly factor 1 subunit A isoform X1
8	885580.XP_010626729.1	0.872	Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family
9	885580.XP_010615714.1	0.858	Proline-rich protein 14 isoform X1
10	885580.XP_010608233.1	0.838	Histone-lysine N-methyltransferase EHMT2
11	885580.XP_010634879.1	0.836	Chromatin assembly factor 1 subunit B
12	885580.XP_010640248.1	0.832	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
13	885580.XP_010633348.1	0.830	Transcription activator BRG1
14	885580.XP_010604137.1	0.819	Protein MIS12 homolog
15	885580.XP_010630025.1	0.809	Transcription intermediary factor 1-alpha
16	885580.XP_010606407.1	0.808	Nuclear autoantigen Sp-100
17	885580.XP_010621401.1	0.797	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
18	885580.XP_010639635.1	0.787	Transcriptional regulator ATRX isoform X1
19	885580.XP_010616516.1	0.778	Activity-dependent neuroprotector homeobox protein
20	885580.XP_010634569.1	0.772	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042393	0.990	histone binding
GO:0140030	0.966	modification-dependent protein binding
GO:0042802	0.965	identical protein binding
GO:0035064	0.955	methylated histone binding
GO:1901363	0.847	heterocyclic compound binding
GO:0003676	0.806	nucleic acid binding
GO:0044877	0.753	protein-containing complex binding
GO:0043021	0.698	ribonucleoprotein complex binding
GO:0003682	0.688	chromatin binding
GO:0003677	0.594	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0010468	0.976	regulation of gene expression
GO:0019219	0.974	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.970	cellular process
GO:0006355	0.955	regulation of DNA-templated transcription
GO:0010605	0.947	negative regulation of macromolecule metabolic process
GO:0048523	0.945	negative regulation of cellular process
GO:0045892	0.875	negative regulation of DNA-templated transcription
GO:0050896	0.715	response to stimulus
GO:0051716	0.640	cellular response to stimulus
GO:0006357	0.627	regulation of transcription by RNA polymerase II
GO:0033554	0.355	cellular response to stress
GO:0071840	0.324	cellular component organization or biogenesis
GO:0048518	0.310	positive regulation of biological process
GO:0016043	0.309	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005694	0.986	chromosome
GO:0000785	0.980	chromatin
GO:0032991	0.973	protein-containing complex
GO:0098687	0.810	chromosomal region
GO:0000792	0.806	heterochromatin
GO:0000781	0.754	chromosome, telomeric region
GO:0005737	0.700	cytoplasm
GO:0000775	0.608	chromosome, centromeric region
GO:0140513	0.577	nuclear protein-containing complex
GO:1902494	0.565	catalytic complex
GO:0012505	0.527	endomembrane system
GO:0031967	0.331	organelle envelope
GO:0016604	0.319	nuclear body
GO:0005635	0.316	nuclear envelope
GO:0005730	0.300	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]