StarFunc result for job id P45974

User Input

>input (858 residues)
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
ADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3ihpB	0.672	0.842	0.000	681	0.793	0.999	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
2	AFDB:P45974	1.000	1.000	0.000	858	1.000	1.000	P45974.pdb.gz	UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2
3	AFDB:Q1MT86	0.802	0.806	0.000	853	0.682	0.686	Q1MT86.pdb.gz	Q1MT86_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fa06b05 PE=1 SV=1
4	AFDB:Q92995	0.762	0.758	0.000	863	0.600	0.597	Q92995.pdb.gz	UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens OX=9606 GN=USP13 PE=1 SV=2
5	AFDB:Q9VZU7	0.820	0.849	1.956E-102	827	0.493	0.511	Q9VZU7.pdb.gz	Q9VZU7_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp5 PE=1 SV=1
6	AFDB:Q8L6Y1	0.707	0.758	9.418E-98	797	0.469	0.504	Q8L6Y1.pdb.gz	UBP14_ARATH Ubiquitin carboxyl-terminal hydrolase 14 OS=Arabidopsis thaliana OX=3702 GN=UBP14 PE=1 SV=1
7	AFDB:P54201	0.760	0.778	1.210E-91	837	0.422	0.432	P54201.pdb.gz	UBPA_DICDI Ubiquitin carboxyl-terminal hydrolase A OS=Dictyostelium discoideum OX=44689 GN=ubpA PE=2 SV=2
8	AFDB:Q11119	0.547	0.600	8.940E-70	775	0.307	0.339	Q11119.pdb.gz	UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp14 PE=1 SV=2
9	AFDB:Q582Q1	0.597	0.687	4.322E-66	731	0.291	0.342	Q582Q1.pdb.gz	Q582Q1_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.520 PE=3 SV=1
10	AFDB:P38237	0.593	0.643	3.368E-58	781	0.276	0.303	P38237.pdb.gz	UBP14_YEAST Ubiquitin carboxyl-terminal hydrolase 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP14 PE=1 SV=2
11	AFDB:Q9LEW0	0.323	0.490	1.237E-25	557	0.118	0.181	Q9LEW0.pdb.gz	UBP22_ARATH Ubiquitin C-terminal hydrolase 22 OS=Arabidopsis thaliana OX=3702 GN=UBP22 PE=1 SV=1
12	PDB:3mhsA	0.311	0.568	2.453E-21	455	0.118	0.222	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
13	PDB:5cvnB	0.293	0.750	5.219E-18	321	0.091	0.243	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
14	PDB:7w3ax	0.276	0.463	1.647E-17	494	0.121	0.211	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
15	PDB:5mpc8	0.288	0.587	1.934E-16	395	0.098	0.213	5mpc8.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
16	PDB:4fjcE	0.269	0.508	4.642E-16	434	0.114	0.226	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
17	PDB:5k16B	0.293	0.712	1.387E-15	328	0.089	0.232	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
18	PDB:4wa6D	0.264	0.522	2.035E-15	415	0.106	0.219	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
19	PDB:7qo48	0.296	0.654	2.261E-14	372	0.096	0.220	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
20	PDB:5gjqx	0.281	0.648	2.973E-14	355	0.087	0.211	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P45974	0.0	1782	858	1.000	1.000	UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2
2	P54201	0.0	665	837	0.425	0.436	UBPA_DICDI Ubiquitin carboxyl-terminal hydrolase A OS=Dictyostelium discoideum OX=44689 GN=ubpA PE=2 SV=2
3	P56399	0.0	1756	858	0.984	0.984	UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus OX=10090 GN=Usp5 PE=1 SV=1
4	Q1MT86	0.0	1191	853	0.692	0.696	Q1MT86_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fa06b05 PE=1 SV=1
5	Q4V973	0.0	1164	834	0.676	0.695	Q4V973_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fc21h02 PE=1 SV=1
6	Q8L6Y1	0.0	766	797	0.474	0.511	UBP14_ARATH Ubiquitin carboxyl-terminal hydrolase 14 OS=Arabidopsis thaliana OX=3702 GN=UBP14 PE=1 SV=1
7	Q92995	0.0	1069	863	0.605	0.601	UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens OX=9606 GN=USP13 PE=1 SV=2
8	Q9VZU7	0.0	837	827	0.499	0.518	Q9VZU7_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp5 PE=1 SV=1
9	Q11119	2.89e-128	405	775	0.329	0.364	UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp14 PE=1 SV=2
10	Q582Q1	3.64e-84	286	731	0.239	0.280	Q582Q1_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.520 PE=3 SV=1
11	P38237	6.13e-80	276	781	0.296	0.325	UBP14_YEAST Ubiquitin carboxyl-terminal hydrolase 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP14 PE=1 SV=2
12	Q9Y6I4	3.49e-15	81.6	520	0.145	0.238	UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=2
13	D3ZN39	8.77e-15	81.3	1081	0.090	0.071	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
14	Q4JL29	9.56e-15	80.5	520	0.145	0.238	Q4JL29_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=2 SV=1
15	Q80U87	1.39e-14	80.9	1080	0.085	0.068	UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus OX=10090 GN=Usp8 PE=1 SV=2
16	A0A8I6A1E0	1.49e-14	80.5	1026	0.090	0.075	A0A8I6A1E0_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=1
17	P40818	3.23e-14	79.7	1118	0.090	0.069	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
18	A1L1I5	4.54e-13	74.3	423	0.083	0.168	A1L1I5_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
19	Q6P8X6	2.59e-12	72.0	390	0.059	0.131	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
20	Q6JHV3	2.82e-12	72.4	498	0.138	0.237	Q6JHV3_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07223 DUF1421	4.2e+02	12.2	UBA-like domain (DUF1421)
2	PF00627 UBA	4.8e-24	95.1	UBA/TS-N domain
3	PF09288 UBA_3	97	14.2	Fungal ubiquitin-associated domain
4	PF14555 UBA_4	46	15.3	UBA-like domain
5	PF00443 UCH	1.1e-50	184.3	Ubiquitin carboxyl-terminal hydrolase
6	PF13423 UCH_1	6.2e-06	37.7	Ubiquitin carboxyl-terminal hydrolase
7	PF02148 zf-UBP	6.8e-14	63.3	Zn-finger in ubiquitin-hydrolases and other protein
8	PF17807 zf-UBP_var	1.3e-26	103.5	Variant UBP zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229268

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441543	0.998	Polyubiquitin-C
2	9606.ENSP00000272317	0.983	Ubiquitin-40S ribosomal protein S27a
3	9606.ENSP00000304697	0.960	Polyubiquitin-B
4	9606.ENSP00000388107	0.943	Ubiquitin-60S ribosomal protein L40
5	9606.ENSP00000261601	0.918	Ubiquitin carboxyl-terminal hydrolase 14
6	9606.ENSP00000334198	0.894	Voltage-dependent T-type calcium channel subunit alpha-1H
7	9606.ENSP00000343535	0.884	Ubiquitin carboxyl-terminal hydrolase 7
8	9606.ENSP00000366819	0.883	Ubiquitin carboxyl-terminal hydrolase isozyme L3
9	9606.ENSP00000356425	0.837	Ubiquitin carboxyl-terminal hydrolase isozyme L5
10	9606.ENSP00000467024	0.823	UV excision repair protein RAD23 homolog A
11	9606.ENSP00000338413	0.817	Ubiquitin-like modifier-activating enzyme 1
12	9606.ENSP00000386541	0.813	26S proteasome non-ATPase regulatory subunit 14
13	9606.ENSP00000203630	0.795	Myeloid leukemia factor 2
14	9606.ENSP00000309474	0.795	26S proteasome non-ATPase regulatory subunit 1
15	9606.ENSP00000003302	0.790	Ubiquitin carboxyl-terminal hydrolase 28
16	9606.ENSP00000377381	0.777	Ubiquitin domain containing 2
17	9606.ENSP00000444357	0.773	Ubiquitin thioesterase OTUB1
18	9606.ENSP00000350708	0.770	UV excision repair protein RAD23 homolog B
19	9606.ENSP00000262525	0.741	Zinc finger protein 629
20	9606.ENSP00000412922	0.741	Ubiquitin-related modifier 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0004197	0.997	cysteine-type endopeptidase activity
GO:0043130	0.996	ubiquitin binding
GO:1990380	0.519	K48-linked deubiquitinase activity
GO:0019899	0.471	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019538	0.987	protein metabolic process
GO:0006508	0.978	proteolysis
GO:0070647	0.978	protein modification by small protein conjugation or removal
GO:0016579	0.974	protein deubiquitination
GO:0050789	0.970	regulation of biological process
GO:0050794	0.961	regulation of cellular process
GO:0031329	0.871	regulation of cellular catabolic process
GO:0030162	0.860	regulation of proteolysis
GO:0051247	0.847	positive regulation of protein metabolic process
GO:0045862	0.842	positive regulation of proteolysis
GO:1903052	0.830	positive regulation of proteolysis involved in protein catabolic process
GO:0061136	0.827	regulation of proteasomal protein catabolic process
GO:0045732	0.817	positive regulation of protein catabolic process
GO:2000058	0.762	regulation of ubiquitin-dependent protein catabolic process
GO:0009987	0.756	cellular process
GO:0032434	0.747	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0048522	0.740	positive regulation of cellular process
GO:1901800	0.712	positive regulation of proteasomal protein catabolic process
GO:0031325	0.612	positive regulation of cellular metabolic process
GO:0031331	0.591	positive regulation of cellular catabolic process
GO:2000060	0.563	positive regulation of ubiquitin-dependent protein catabolic process
GO:0032446	0.471	protein modification by small protein conjugation
GO:0032436	0.447	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0050896	0.351	response to stimulus
GO:0016567	0.306	protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.966	nucleus
GO:0070013	0.936	intracellular organelle lumen
GO:0005654	0.922	nucleoplasm
GO:0005773	0.692	vacuole
GO:0005764	0.589	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.997	Cysteine endopeptidases.

[back to server]