StarFunc result for job id P45983

User Input

>input (427 residues)
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49185	0.906	0.941	1.679E-67	411	0.951	0.988	P49185.pdb.gz	MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus OX=10116 GN=Mapk8 PE=1 SV=1
2	AFDB:A0A0R4IKK9	0.890	0.806	1.040E-63	472	0.899	0.814	A0A0R4IKK9.pdb.gz	A0A0R4IKK9_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=2
3	AFDB:P45984	0.876	0.883	8.530E-61	424	0.808	0.814	P45984.pdb.gz	MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=2
4	AFDB:Q9DGD9	0.877	0.975	9.567E-60	384	0.768	0.854	Q9DGD9.pdb.gz	MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio OX=7955 GN=mapk8 PE=2 SV=1
5	AFDB:E9QE29	0.873	0.885	4.632E-56	421	0.742	0.753	E9QE29.pdb.gz	E9QE29_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=mapk9 PE=1 SV=1
6	AFDB:P92208	0.838	0.962	5.826E-54	372	0.658	0.755	P92208.pdb.gz	JNK_DROME Stress-activated protein kinase JNK OS=Drosophila melanogaster OX=7227 GN=bsk PE=1 SV=1
7	PDB:1jnkA	0.775	0.954	3.381E-49	346	0.752	0.928	1jnkA.pdb.gz	Crystal structure of JNK3: a kinase implicated in neuronal apoptosis.
8	AFDB:Q8WQG9	0.824	0.761	1.104E-47	463	0.581	0.536	Q8WQG9.pdb.gz	JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans OX=6239 GN=jnk-1 PE=1 SV=2
9	PDB:5awmA	0.764	0.940	2.388E-43	345	0.628	0.777	5awmA.pdb.gz	The crystal structure of JNK from Drosophila melanogaster reveals an evolutionarily conserved topology with that of mammalian JNK proteins.
10	AFDB:J3KNK1	0.632	0.791	2.196E-41	339	0.667	0.841	J3KNK1.pdb.gz	J3KNK1_HUMAN Stress-activated protein kinase JNK OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=1
11	AFDB:O44408	0.822	0.898	1.744E-40	390	0.422	0.462	O44408.pdb.gz	KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans OX=6239 GN=kgb-1 PE=1 SV=2
12	AFDB:O08911	0.784	0.908	4.165E-38	367	0.405	0.471	O08911.pdb.gz	MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus OX=10090 GN=Mapk12 PE=1 SV=1
13	PDB:2ewaA	0.708	0.906	9.620E-33	330	0.377	0.488	2ewaA.pdb.gz	NMR characterization of kinase p38 dynamics in free and ligand-bound forms.
14	PDB:2lgcA	0.726	0.855	1.115E-32	359	0.400	0.476	2lgcA.pdb.gz
15	PDB:3gc8A	0.725	0.885	2.016E-32	347	0.398	0.490	3gc8A.pdb.gz	The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
16	PDB:7cgaA	0.732	0.892	2.580E-32	347	0.384	0.473	7cgaA.pdb.gz
17	PDB:3coiA	0.691	0.845	6.372E-31	344	0.379	0.471	3coiA.pdb.gz
18	PDB:2zoqA	0.729	0.877	2.335E-29	352	0.330	0.401	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
19	PDB:7opmA	0.753	0.882	3.464E-29	362	0.342	0.403	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
20	PDB:5bvdA	0.720	0.924	1.707E-27	330	0.333	0.430	5bvdA.pdb.gz	Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4I9H8	742	384	0.815	0.906	A0A0R4I9H8_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=1
2	A0A0R4IB91	734	433	0.815	0.804	A0A0R4IB91_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=1
3	A0A0R4IKK9	795	472	0.902	0.816	A0A0R4IKK9_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=2
4	A0A286YFD7	798	426	0.895	0.897	A0A286YFD7_HUMAN Stress-activated protein kinase JNK OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=1
5	A4QP40	738	384	0.813	0.904	A4QP40_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=mapk10 PE=2 SV=1
6	E9QE29	646	421	0.735	0.746	E9QE29_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=mapk9 PE=1 SV=1
7	P45983	895	427	1.000	1.000	MK08_HUMAN Mitogen-activated protein kinase 8 OS=Homo sapiens OX=9606 GN=MAPK8 PE=1 SV=2
8	P45984	726	424	0.808	0.814	MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=2
9	P49185	849	411	0.951	0.988	MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus OX=10116 GN=Mapk8 PE=1 SV=1
10	P49186	719	423	0.808	0.816	MK09_RAT Mitogen-activated protein kinase 9 OS=Rattus norvegicus OX=10116 GN=Mapk9 PE=1 SV=1
11	P49187	807	464	0.909	0.836	MK10_RAT Mitogen-activated protein kinase 10 OS=Rattus norvegicus OX=10116 GN=Mapk10 PE=1 SV=3
12	P53779	807	464	0.909	0.836	MK10_HUMAN Mitogen-activated protein kinase 10 OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=2
13	P79996	671	382	0.740	0.827	MK09_CHICK Mitogen-activated protein kinase 9 OS=Gallus gallus OX=9031 GN=MAPK9 PE=2 SV=1
14	P92208	611	372	0.663	0.761	JNK_DROME Stress-activated protein kinase JNK OS=Drosophila melanogaster OX=7227 GN=bsk PE=1 SV=1
15	Q32LV0	735	430	0.815	0.809	Q32LV0_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=1
16	Q499Y8	589	319	0.665	0.890	Q499Y8_HUMAN Stress-activated protein kinase JNK OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=1
17	Q61831	809	464	0.902	0.830	MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus OX=10090 GN=Mapk10 PE=1 SV=2
18	Q8WQG9	541	463	0.583	0.538	JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans OX=6239 GN=jnk-1 PE=1 SV=2
19	Q91Y86	798	384	0.888	0.987	MK08_MOUSE Mitogen-activated protein kinase 8 OS=Mus musculus OX=10090 GN=Mapk8 PE=1 SV=1
20	Q9DGD9	709	384	0.768	0.854	MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio OX=7955 GN=mapk8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.038	24.7	ABC1 atypical kinase-like domain
2	PF01636 APH	3.7	18.9	Phosphotransferase enzyme family
3	PF04409 DUF530	2.3e+02	11.6	Protein of unknown function (DUF530)
4	PF13095 FTA2	1.5e+02	13.4	Kinetochore Sim4 complex subunit FTA2
5	PF06293 Kdo	0.0038	28.2	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	0.35	21.7	Kinase-like
7	PF00069 Pkinase	5.2e-60	214.6	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	7.3e-26	102.6	Protein tyrosine and serine/threonine kinase
9	PF01163 RIO1	1.5	19.9	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 30611.ENSOGAP00000007309

Rank	PPI partner	STRING score	Description
1	30611.ENSOGAP00000017292	0.998	Jun proto-oncogene, AP-1 transcription factor subunit
2	30611.ENSOGAP00000015106	0.995	Cellular tumor antigen p53
3	30611.ENSOGAP00000011248	0.993	Mitogen-activated protein kinase 8 interacting protein 1
4	30611.ENSOGAP00000011328	0.993	Mitogen-activated protein kinase 8 interacting protein 3
5	30611.ENSOGAP00000014875	0.991	Belongs to the protein kinase superfamily.
6	30611.ENSOGAP00000020544	0.991	Dual specificity phosphatase 16
7	30611.ENSOGAP00000002413	0.989	Mitogen-activated protein kinase kinase kinase 1 (Predicted)
8	30611.ENSOGAP00000005497	0.986	CRK proto-oncogene, adaptor protein
9	30611.ENSOGAP00000011532	0.985	Mitogen-activated protein kinase kinase 7
10	30611.ENSOGAP00000021983	0.982	Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
11	30611.ENSOGAP00000003021	0.980	Dual specificity phosphatase 10
12	30611.ENSOGAP00000010387	0.980	ELK1, member of ETS oncogene family
13	30611.ENSOGAP00000016104	0.978	Insulin receptor substrate 1
14	30611.ENSOGAP00000011115	0.977	BCL2-like 1
15	30611.ENSOGAP00000018331	0.977	HRas proto-oncogene, GTPase
16	30611.ENSOGAP00000010191	0.975	Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequences (5'-TGACGTCA- 3') or to AP-1 (activator protein 1) consensus sequences (5'-TGACTCA- 3')
17	30611.ENSOGAP00000015111	0.975	Mitogen-activated protein kinase 9
18	30611.ENSOGAP00000022534	0.971	Ras homolog family member A
19	30611.ENSOGAP00000005397	0.970	Mitogen-activated protein kinase kinase kinase 7
20	30611.ENSOGAP00000019347	0.970	Mitogen-activated protein kinase 8 interacting protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004707	0.996	MAP kinase activity
GO:1901363	0.340	heterocyclic compound binding
GO:0097159	0.340	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.967	response to stimulus
GO:0031098	0.944	stress-activated protein kinase signaling cascade
GO:0000165	0.930	MAPK cascade
GO:0051403	0.917	stress-activated MAPK cascade
GO:0019222	0.916	regulation of metabolic process
GO:0007254	0.907	JNK cascade
GO:0048522	0.895	positive regulation of cellular process
GO:0062197	0.842	cellular response to chemical stress
GO:0006793	0.805	phosphorus metabolic process
GO:0060255	0.764	regulation of macromolecule metabolic process
GO:0016310	0.758	phosphorylation
GO:0032501	0.722	multicellular organismal process
GO:0051171	0.714	regulation of nitrogen compound metabolic process
GO:0048583	0.706	regulation of response to stimulus
GO:0080090	0.706	regulation of primary metabolic process
GO:0031323	0.704	regulation of cellular metabolic process
GO:0009889	0.642	regulation of biosynthetic process
GO:0018105	0.623	peptidyl-serine phosphorylation
GO:0009893	0.584	positive regulation of metabolic process
GO:0043067	0.580	regulation of programmed cell death
GO:0042981	0.558	regulation of apoptotic process
GO:0048856	0.556	anatomical structure development
GO:0065009	0.541	regulation of molecular function
GO:0023051	0.531	regulation of signaling
GO:0010646	0.531	regulation of cell communication
GO:0010033	0.513	response to organic substance
GO:0007275	0.486	multicellular organism development
GO:0010604	0.465	positive regulation of macromolecule metabolic process
GO:0009966	0.461	regulation of signal transduction
GO:0048513	0.452	animal organ development
GO:0010468	0.443	regulation of gene expression
GO:0007399	0.441	nervous system development
GO:0031326	0.437	regulation of cellular biosynthetic process
GO:0010038	0.375	response to metal ion
GO:0080134	0.339	regulation of response to stress
GO:1901700	0.328	response to oxygen-containing compound
GO:1902531	0.314	regulation of intracellular signal transduction
GO:0010556	0.308	regulation of macromolecule biosynthetic process
GO:0006355	0.303	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005654	0.963	nucleoplasm
GO:0005829	0.934	cytosol
GO:0012505	0.461	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.24	0.996	mitogen-activated protein kinase.

[back to server]