StarFunc result for job id P45984

User Input

>input (424 residues)
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P45984	1.000	1.000	4.292E-71	424	1.000	1.000	P45984.pdb.gz	MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=2
2	AFDB:E9QE29	0.889	0.895	3.152E-61	421	0.840	0.846	E9QE29.pdb.gz	E9QE29_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=mapk9 PE=1 SV=1
3	AFDB:A0A0R4IKK9	0.874	0.786	3.545E-60	472	0.830	0.746	A0A0R4IKK9.pdb.gz	A0A0R4IKK9_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=2
4	AFDB:P49185	0.878	0.905	1.181E-58	411	0.785	0.810	P49185.pdb.gz	MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus OX=10116 GN=Mapk8 PE=1 SV=1
5	AFDB:Q9DGD9	0.877	0.967	6.990E-58	384	0.710	0.784	Q9DGD9.pdb.gz	MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio OX=7955 GN=mapk8 PE=2 SV=1
6	AFDB:P92208	0.851	0.969	4.827E-54	372	0.642	0.731	P92208.pdb.gz	JNK_DROME Stress-activated protein kinase JNK OS=Drosophila melanogaster OX=7227 GN=bsk PE=1 SV=1
7	AFDB:Q8WQG9	0.831	0.762	9.577E-49	463	0.585	0.536	Q8WQG9.pdb.gz	JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans OX=6239 GN=jnk-1 PE=1 SV=2
8	PDB:1jnkA	0.786	0.961	6.061E-48	346	0.712	0.873	1jnkA.pdb.gz	Crystal structure of JNK3: a kinase implicated in neuronal apoptosis.
9	AFDB:J3KNK1	0.663	0.826	2.669E-46	339	0.797	0.997	J3KNK1.pdb.gz	J3KNK1_HUMAN Stress-activated protein kinase JNK OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=1
10	PDB:5awmA	0.781	0.955	1.786E-42	345	0.618	0.759	5awmA.pdb.gz	The crystal structure of JNK from Drosophila melanogaster reveals an evolutionarily conserved topology with that of mammalian JNK proteins.
11	AFDB:O44408	0.834	0.905	2.111E-40	390	0.425	0.462	O44408.pdb.gz	KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans OX=6239 GN=kgb-1 PE=1 SV=2
12	AFDB:A0A024RD15	0.765	0.897	3.771E-38	360	0.422	0.497	A0A024RD15.pdb.gz
13	PDB:2ewaA	0.715	0.909	3.632E-33	330	0.403	0.518	2ewaA.pdb.gz	NMR characterization of kinase p38 dynamics in free and ligand-bound forms.
14	PDB:2lgcA	0.732	0.859	4.009E-33	359	0.425	0.501	2lgcA.pdb.gz
15	PDB:7cgaA	0.744	0.901	4.884E-33	347	0.389	0.476	7cgaA.pdb.gz
16	PDB:3gc8A	0.735	0.890	4.976E-32	347	0.387	0.473	3gc8A.pdb.gz	The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
17	PDB:3coiA	0.702	0.852	1.475E-31	344	0.377	0.465	3coiA.pdb.gz
18	PDB:2zoqA	0.738	0.883	3.478E-30	352	0.333	0.401	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
19	PDB:7opmA	0.749	0.873	6.610E-30	362	0.337	0.395	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
20	PDB:5bvdA	0.726	0.926	1.721E-28	330	0.325	0.418	5bvdA.pdb.gz	Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4I9H8	693	384	0.767	0.846	A0A0R4I9H8_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=1
2	A0A0R4IB91	686	433	0.767	0.751	A0A0R4IB91_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=1
3	A0A0R4IKK9	733	472	0.840	0.754	A0A0R4IKK9_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=2
4	A0A286YFD7	749	426	0.851	0.847	A0A286YFD7_HUMAN Stress-activated protein kinase JNK OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=1
5	A4QP40	691	384	0.764	0.844	A4QP40_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=mapk10 PE=2 SV=1
6	E9QE29	731	421	0.840	0.846	E9QE29_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=mapk9 PE=1 SV=1
7	P45983	701	427	0.814	0.808	MK08_HUMAN Mitogen-activated protein kinase 8 OS=Homo sapiens OX=9606 GN=MAPK8 PE=1 SV=2
8	P45984	888	424	1.000	1.000	MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens OX=9606 GN=MAPK9 PE=1 SV=2
9	P49185	699	411	0.785	0.810	MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus OX=10116 GN=Mapk8 PE=1 SV=1
10	P49186	873	423	0.988	0.991	MK09_RAT Mitogen-activated protein kinase 9 OS=Rattus norvegicus OX=10116 GN=Mapk9 PE=1 SV=1
11	P49187	739	464	0.844	0.772	MK10_RAT Mitogen-activated protein kinase 10 OS=Rattus norvegicus OX=10116 GN=Mapk10 PE=1 SV=3
12	P53779	738	464	0.844	0.772	MK10_HUMAN Mitogen-activated protein kinase 10 OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=2
13	P79996	791	382	0.880	0.976	MK09_CHICK Mitogen-activated protein kinase 9 OS=Gallus gallus OX=9031 GN=MAPK9 PE=2 SV=1
14	P92208	595	372	0.642	0.731	JNK_DROME Stress-activated protein kinase JNK OS=Drosophila melanogaster OX=7227 GN=bsk PE=1 SV=1
15	Q32LV0	686	430	0.767	0.756	Q32LV0_DANRE Stress-activated protein kinase JNK OS=Danio rerio OX=7955 GN=zgc:123234 PE=1 SV=1
16	Q499Y8	551	319	0.627	0.834	Q499Y8_HUMAN Stress-activated protein kinase JNK OS=Homo sapiens OX=9606 GN=MAPK10 PE=1 SV=1
17	Q61831	743	464	0.840	0.767	MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus OX=10090 GN=Mapk10 PE=1 SV=2
18	Q8WQG9	541	463	0.580	0.531	JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans OX=6239 GN=jnk-1 PE=1 SV=2
19	Q91Y86	673	384	0.748	0.826	MK08_MOUSE Mitogen-activated protein kinase 8 OS=Mus musculus OX=10090 GN=Mapk8 PE=1 SV=1
20	Q9DGD9	658	384	0.710	0.784	MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio OX=7955 GN=mapk8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.03	25.0	ABC1 atypical kinase-like domain
2	PF01636 APH	2.3	19.6	Phosphotransferase enzyme family
3	PF07362 CcdA	8.2e+02	11.9	Post-segregation antitoxin CcdA
4	PF13095 FTA2	2.4e+02	12.8	Kinetochore Sim4 complex subunit FTA2
5	PF06293 Kdo	0.031	25.2	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	1.2	20.0	Kinase-like
7	PF00069 Pkinase	2.2e-60	215.9	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	4.1e-26	103.4	Protein tyrosine and serine/threonine kinase
9	PF01163 RIO1	1.7	19.7	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002611

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017965	0.989	Jun proto-oncogene, AP-1 transcription factor subunit
2	61853.ENSNLEP00000017716	0.984	Belongs to the protein kinase superfamily.
3	61853.ENSNLEP00000011861	0.972	Cellular tumor antigen p53
4	61853.ENSNLEP00000018944	0.971	Mitogen-activated protein kinase 8
5	61853.ENSNLEP00000006197	0.959	Uncharacterized protein
6	61853.ENSNLEP00000010020	0.955	Cell division cycle 42
7	61853.ENSNLEP00000011344	0.952	Mitogen-activated protein kinase 10
8	61853.ENSNLEP00000019981	0.951	Fos proto-oncogene, AP-1 transcription factor subunit
9	61853.ENSNLEP00000023548	0.949	Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequences (5'-TGACGTCA- 3') or to AP-1 (activator protein 1) consensus sequences (5'-TGACTCA- 3')
10	61853.ENSNLEP00000021805	0.946	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
11	61853.ENSNLEP00000002707	0.942	Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
12	61853.ENSNLEP00000001083	0.937	RAS like proto-oncogene B
13	61853.ENSNLEP00000023909	0.937	RAS like proto-oncogene A
14	61853.ENSNLEP00000006908	0.935	Dual specificity phosphatase 3
15	61853.ENSNLEP00000005992	0.934	BCL2-associated agonist of cell death
16	61853.ENSNLEP00000021481	0.933	Sp1 transcription factor
17	61853.ENSNLEP00000000851	0.926	CRK proto-oncogene, adaptor protein
18	61853.ENSNLEP00000001323	0.926	Uncharacterized protein
19	61853.ENSNLEP00000012221	0.925	B-cell CLL/lymphoma 10
20	61853.ENSNLEP00000017956	0.924	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004707	0.995	MAP kinase activity
GO:0019899	0.341	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0051716	0.983	cellular response to stimulus
GO:0007154	0.980	cell communication
GO:0023052	0.978	signaling
GO:0007165	0.970	signal transduction
GO:0008152	0.959	metabolic process
GO:0071704	0.941	organic substance metabolic process
GO:0044237	0.939	cellular metabolic process
GO:0044238	0.926	primary metabolic process
GO:0010468	0.926	regulation of gene expression
GO:0006793	0.914	phosphorus metabolic process
GO:0016310	0.902	phosphorylation
GO:0031098	0.897	stress-activated protein kinase signaling cascade
GO:0006468	0.891	protein phosphorylation
GO:0051246	0.863	regulation of protein metabolic process
GO:0048522	0.861	positive regulation of cellular process
GO:0042221	0.858	response to chemical
GO:0009889	0.831	regulation of biosynthetic process
GO:0000165	0.827	MAPK cascade
GO:0031323	0.816	regulation of cellular metabolic process
GO:0070887	0.799	cellular response to chemical stimulus
GO:0009893	0.798	positive regulation of metabolic process
GO:0048583	0.761	regulation of response to stimulus
GO:0010604	0.757	positive regulation of macromolecule metabolic process
GO:0065009	0.735	regulation of molecular function
GO:1901700	0.726	response to oxygen-containing compound
GO:0032502	0.706	developmental process
GO:1901701	0.696	cellular response to oxygen-containing compound
GO:0010556	0.687	regulation of macromolecule biosynthetic process
GO:0031326	0.683	regulation of cellular biosynthetic process
GO:0019219	0.650	regulation of nucleobase-containing compound metabolic process
GO:0018105	0.650	peptidyl-serine phosphorylation
GO:0046686	0.644	response to cadmium ion
GO:0007254	0.636	JNK cascade
GO:0032501	0.624	multicellular organismal process
GO:0048519	0.615	negative regulation of biological process
GO:0071276	0.614	cellular response to cadmium ion
GO:0031325	0.588	positive regulation of cellular metabolic process
GO:0048523	0.572	negative regulation of cellular process
GO:0051173	0.565	positive regulation of nitrogen compound metabolic process
GO:0051252	0.565	regulation of RNA metabolic process
GO:2001141	0.563	regulation of RNA biosynthetic process
GO:0006355	0.552	regulation of DNA-templated transcription
GO:0009966	0.487	regulation of signal transduction
GO:0010033	0.480	response to organic substance
GO:0062197	0.475	cellular response to chemical stress
GO:0048856	0.472	anatomical structure development
GO:0048584	0.407	positive regulation of response to stimulus
GO:0007166	0.373	cell surface receptor signaling pathway
GO:0010941	0.345	regulation of cell death
GO:1902531	0.338	regulation of intracellular signal transduction
GO:0071840	0.333	cellular component organization or biogenesis
GO:0051247	0.333	positive regulation of protein metabolic process
GO:0071310	0.329	cellular response to organic substance
GO:0051239	0.319	regulation of multicellular organismal process
GO:0043067	0.315	regulation of programmed cell death
GO:0009891	0.315	positive regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.996	nucleoplasm
GO:0016020	0.819	membrane
GO:0005886	0.389	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.24	0.995	mitogen-activated protein kinase.

[back to server]