StarFunc result for job id P45985

User Input

>input (399 residues)
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:S4VP54	0.815	0.797	2.588E-70	408	0.977	0.956	S4VP54.pdb.gz	S4VP54_RAT MAP2K4delta OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
2	AFDB:B1NA68	0.787	0.777	1.772E-63	404	0.865	0.854	B1NA68.pdb.gz	B1NA68_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=map2k4A PE=1 SV=1
3	AFDB:A4UU31	0.810	0.776	4.328E-63	417	0.855	0.818	A4UU31.pdb.gz	A4UU31_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=MKK4B PE=1 SV=1
4	AFDB:O61444	0.757	0.713	1.943E-46	424	0.559	0.526	O61444.pdb.gz	O61444_DROME MAP kinase kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=1 SV=1
5	AFDB:Q9DGE0	0.724	0.798	1.079E-40	361	0.464	0.512	Q9DGE0.pdb.gz	MP2K6_DANRE Dual specificity mitogen-activated protein kinase kinase 6 OS=Danio rerio OX=7955 GN=map2k6 PE=1 SV=2
6	AFDB:Q20347	0.739	0.810	1.595E-40	363	0.429	0.471	Q20347.pdb.gz	MKK4_CAEEL MAP kinase kinase mkk-4 OS=Caenorhabditis elegans OX=6239 GN=mkk-4 PE=2 SV=3
7	AFDB:A8K3Y2	0.718	0.852	2.230E-40	334	0.444	0.530	A8K3Y2.pdb.gz	A8K3Y2_HUMAN Mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=2 SV=1
8	AFDB:Q9I959	0.708	0.699	3.685E-40	404	0.461	0.455	Q9I959.pdb.gz	Q9I959_CYPCA MAP kinase kinase 6 (MKK6) OS=Cyprinus carpio OX=7962 PE=2 SV=1
9	AFDB:B1H230	0.729	0.835	6.089E-40	347	0.446	0.513	B1H230.pdb.gz	B1H230_RAT Map2k3 protein OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=2 SV=1
10	AFDB:Q9U983	0.712	0.842	5.369E-39	335	0.429	0.510	Q9U983.pdb.gz	Q9U983_DROME MAPKK OS=Drosophila melanogaster OX=7227 GN=lic PE=2 SV=1
11	PDB:8a8mB	0.616	0.805	4.115E-28	298	0.398	0.534	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
12	PDB:3eqdA	0.653	0.819	1.188E-27	315	0.298	0.378	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
13	PDB:5eymA	0.618	0.833	1.569E-23	292	0.291	0.397	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
14	PDB:4ek6A	0.518	0.727	1.089E-17	279	0.168	0.240	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
15	PDB:4eomC	0.539	0.756	7.683E-17	276	0.170	0.246	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:4yc3A	0.529	0.697	1.016E-16	295	0.160	0.217	4yc3A.pdb.gz
17	PDB:6s73A	0.560	0.810	1.587E-16	269	0.190	0.283	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:4krcA	0.524	0.690	1.775E-16	297	0.170	0.229	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:4gcjA	0.520	0.670	2.346E-16	304	0.173	0.227	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
20	PDB:3coiA	0.492	0.560	3.279E-16	344	0.185	0.215	3coiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4UU31	0.0	676	417	0.812	0.777	A4UU31_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=MKK4B PE=1 SV=1
2	B1NA68	0.0	687	404	0.847	0.837	B1NA68_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=map2k4A PE=1 SV=1
3	F1LP57	0.0	747	371	0.897	0.965	F1LP57_RAT Mitogen activated protein kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=4
4	P45985	0.0	830	399	1.000	1.000	MP2K4_HUMAN Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1
5	P47809	0.0	806	397	0.977	0.982	MP2K4_MOUSE Dual specificity mitogen-activated protein kinase kinase 4 OS=Mus musculus OX=10090 GN=Map2k4 PE=1 SV=2
6	Q4KSH6	0.0	806	397	0.977	0.982	Q4KSH6_RAT Dual specificity mitogen-activated protein kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
7	S4VP54	0.0	798	408	0.977	0.956	S4VP54_RAT MAP2K4delta OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
8	Q7KPX5	7.01e-150	432	424	0.541	0.509	Q7KPX5_DROME MAP kinase kinase 4 OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=2 SV=1
9	Q7KPK6	9.31e-150	432	424	0.539	0.507	Q7KPK6_DROME JNK kinase 2 OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=2 SV=1
10	O61444	2.13e-149	431	424	0.539	0.507	O61444_DROME MAP kinase kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=1 SV=1
11	Q9DGE0	1.07e-125	369	361	0.431	0.476	MP2K6_DANRE Dual specificity mitogen-activated protein kinase kinase 6 OS=Danio rerio OX=7955 GN=map2k6 PE=1 SV=2
12	P70236	5.19e-125	366	334	0.434	0.518	MP2K6_MOUSE Dual specificity mitogen-activated protein kinase kinase 6 OS=Mus musculus OX=10090 GN=Map2k6 PE=1 SV=1
13	Q9I959	5.45e-125	369	404	0.431	0.426	Q9I959_CYPCA MAP kinase kinase 6 (MKK6) OS=Cyprinus carpio OX=7962 PE=2 SV=1
14	Q925D6	7.68e-125	365	334	0.434	0.518	Q925D6_RAT Mitogen-activated protein kinase kinase 6 OS=Rattus norvegicus OX=10116 GN=Map2k6 PE=1 SV=1
15	A8K3Y2	2.07e-124	364	334	0.429	0.512	A8K3Y2_HUMAN Mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=2 SV=1
16	P52564	2.07e-124	364	334	0.429	0.512	MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=1 SV=1
17	O62602	2.68e-120	354	334	0.434	0.518	O62602_DROME Licorne OS=Drosophila melanogaster OX=7227 GN=lic PE=1 SV=1
18	Q9U983	4.01e-120	353	335	0.426	0.507	Q9U983_DROME MAPKK OS=Drosophila melanogaster OX=7227 GN=lic PE=2 SV=1
19	O09110	4.15e-120	354	347	0.441	0.507	MP2K3_MOUSE Dual specificity mitogen-activated protein kinase kinase 3 OS=Mus musculus OX=10090 GN=Map2k3 PE=1 SV=2
20	B1H230	9.40e-120	353	347	0.439	0.504	B1H230_RAT Map2k3 protein OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	6.6	17.3	ABC1 atypical kinase-like domain
2	PF01636 APH	5e+02	11.9	Phosphotransferase enzyme family
3	PF12330 Haspin_kinase	77	13.7	Haspin like kinase domain
4	PF14531 Kinase-like	0.00096	30.2	Kinase-like
5	PF00069 Pkinase	8.6e-57	204.1	Protein kinase domain
6	PF17667 Pkinase_fungal	6.4	17.1	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	5.6e-35	132.4	Protein tyrosine and serine/threonine kinase
8	PF07387 Seadorna_VP7	1.7	19.3	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017716

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002707	0.994	Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
2	61853.ENSNLEP00000018944	0.993	Mitogen-activated protein kinase 8
3	61853.ENSNLEP00000011344	0.988	Mitogen-activated protein kinase 10
4	61853.ENSNLEP00000002611	0.984	Mitogen-activated protein kinase 9
5	61853.ENSNLEP00000018084	0.984	Mitogen-activated protein kinase kinase kinase 5
6	61853.ENSNLEP00000010857	0.968	Mitogen-activated protein kinase 14
7	61853.ENSNLEP00000016274	0.963	Mitogen-activated protein kinase kinase kinase 7
8	61853.ENSNLEP00000000724	0.954	Mitogen-activated protein kinase 12
9	61853.ENSNLEP00000010961	0.949	Mitogen-activated protein kinase 13
10	61853.ENSNLEP00000018508	0.947	TGF-beta activated kinase 1/MAP3K7 binding protein 1
11	61853.ENSNLEP00000024234	0.944	Mitogen-activated protein kinase kinase kinase 8
12	61853.ENSNLEP00000021101	0.943	Arrestin, beta 2
13	61853.ENSNLEP00000018580	0.939	TGF-beta activated kinase 1/MAP3K7 binding protein 2
14	61853.ENSNLEP00000012346	0.932	TGF-beta activated kinase 1/MAP3K7 binding protein 3
15	61853.ENSNLEP00000000851	0.925	CRK proto-oncogene, adaptor protein
16	61853.ENSNLEP00000019078	0.919	Mitogen-activated protein kinase kinase kinase 2
17	61853.ENSNLEP00000023541	0.918	Uncharacterized protein
18	61853.ENSNLEP00000019838	0.906	V-akt murine thymoma viral oncogene homolog 1
19	61853.ENSNLEP00000000117	0.895	CRK like proto-oncogene, adaptor protein
20	61853.ENSNLEP00000004803	0.891	V-akt murine thymoma viral oncogene homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004708	0.999	MAP kinase kinase activity
GO:0004674	0.725	protein serine/threonine kinase activity
GO:0019899	0.559	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006950	0.986	response to stress
GO:0000165	0.985	MAPK cascade
GO:0048583	0.984	regulation of response to stimulus
GO:0051403	0.980	stress-activated MAPK cascade
GO:0048518	0.967	positive regulation of biological process
GO:0007254	0.963	JNK cascade
GO:0060255	0.949	regulation of macromolecule metabolic process
GO:0031323	0.926	regulation of cellular metabolic process
GO:0071704	0.919	organic substance metabolic process
GO:1901214	0.882	regulation of neuron death
GO:0009893	0.870	positive regulation of metabolic process
GO:0080090	0.868	regulation of primary metabolic process
GO:0051171	0.855	regulation of nitrogen compound metabolic process
GO:0032501	0.849	multicellular organismal process
GO:0042981	0.841	regulation of apoptotic process
GO:0016310	0.827	phosphorylation
GO:0043408	0.818	regulation of MAPK cascade
GO:0090398	0.815	cellular senescence
GO:0010604	0.814	positive regulation of macromolecule metabolic process
GO:0003012	0.795	muscle system process
GO:0042221	0.785	response to chemical
GO:0048522	0.773	positive regulation of cellular process
GO:0048584	0.770	positive regulation of response to stimulus
GO:0044238	0.751	primary metabolic process
GO:1902533	0.699	positive regulation of intracellular signal transduction
GO:0031325	0.682	positive regulation of cellular metabolic process
GO:0043170	0.675	macromolecule metabolic process
GO:0048519	0.646	negative regulation of biological process
GO:0006807	0.641	nitrogen compound metabolic process
GO:0010942	0.617	positive regulation of cell death
GO:0032502	0.608	developmental process
GO:0048523	0.608	negative regulation of cellular process
GO:0051173	0.578	positive regulation of nitrogen compound metabolic process
GO:1901564	0.565	organonitrogen compound metabolic process
GO:0051246	0.559	regulation of protein metabolic process
GO:0019538	0.559	protein metabolic process
GO:0036211	0.547	protein modification process
GO:0019219	0.542	regulation of nucleobase-containing compound metabolic process
GO:0051247	0.542	positive regulation of protein metabolic process
GO:0009889	0.538	regulation of biosynthetic process
GO:0031399	0.517	regulation of protein modification process
GO:0070887	0.513	cellular response to chemical stimulus
GO:0010468	0.511	regulation of gene expression
GO:0010556	0.487	regulation of macromolecule biosynthetic process
GO:0080134	0.475	regulation of response to stress
GO:0010033	0.465	response to organic substance
GO:0065009	0.448	regulation of molecular function
GO:0048856	0.434	anatomical structure development
GO:0007166	0.434	cell surface receptor signaling pathway
GO:0006468	0.417	protein phosphorylation
GO:0031401	0.407	positive regulation of protein modification process
GO:0043410	0.390	positive regulation of MAPK cascade
GO:0007275	0.379	multicellular organism development
GO:0019220	0.365	regulation of phosphate metabolic process
GO:0045937	0.347	positive regulation of phosphate metabolic process
GO:0044093	0.345	positive regulation of molecular function
GO:0031326	0.341	regulation of cellular biosynthetic process
GO:0001934	0.341	positive regulation of protein phosphorylation
GO:0050790	0.338	regulation of catalytic activity
GO:0043065	0.322	positive regulation of apoptotic process
GO:0006355	0.317	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070013	0.918	intracellular organelle lumen
GO:0043231	0.832	intracellular membrane-bounded organelle
GO:0005634	0.747	nucleus
GO:0016020	0.310	membrane
GO:0031981	0.310	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.12.2	0.999	mitogen-activated protein kinase kinase.

[back to server]