StarFunc result for job id P46013

User Input

>input (1400 residues)
MWPTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAIL
HNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQNGRKSTEFPRKIREQEP
ARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHIKNVKEDSTADDSKDSVAQGTT
NVHSSEHAGRNGRNAADPISGDFKEISSVKLVSRYGELKSVPTTQCLDNSKKNESPFWKL
YESVKKELDVKSQKENVLQYCRKSGLQTDYATEKESADGLQGETQLLVSRKSRPKSGGSG
HAVAEPASPEQELDQNKGKGRDVESVQTPSKAVGASFPLYEPAKMKTPVQYSQQQNSPQK
HKNKDLYTTGRRESVNLGKSEGFKAGDKTLTPRKLSTRNRTPAKVEDAADSATKPENLSS
KTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLPG
LSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLV
MHTPPVLKKIIKEQPQPSGKQESGSEIHVEVKAQSLVISPPAPSPRKTPVASDQRRRSCK
TAPASSSKSQTEVPKRGGRKSGNLPSKRVSISRSQHDILQMICSKRRSGASEANLIVAKS
WADVVKLGAKQTQTKVIKHGPQRSMNKRQRRPATPKKPVGEVHSQFSTGHANSPCTIIIG
KAHTEKVHVPARPYRVLNNFISNQKMDFKEDLSGIAEMFKTPVKEQPQLTSTCHIAISNS
ENLLGKQFQGTDSGEEPLLPTSESFGGNVFFSAQNAAKQPSDKCSASPPLRRQCIRENGN
VAKTPRNTYKMTSLETKTSDTETEPSKTVSTANRSGRSTEFRNIQKLPVESKSEETNTEI
VECILKRGQKATLLQQRREGEMKEIERPFETYKENIELKENDEKMKAMKRSRTWGQKCAP
MSDLTDLKSLPDTELMKDTARGQNLLQTQDHAKAPKSEKGKITKMPCQSLQPEPINTPTH
TKQQLKASLGKVGVKEELLAVGKFTRTSGETTHTHREPAGDGKSIRTFKESPKQILDPAA
RVTGMKKWPRTPKEEAQSLEDLAGFKELFQTPGPSEESMTDEKTTKIACKSPPPESVDTP
TSTKQWPKRSLRKADVEEEFLALRKLTPSAGKAMLTPKPAGGDEKDIKAFMGTPVQKLDL
AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVD
TPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPKPSVGEEKDIIIFVGTPVQKL
DLTENLTGSKRRPQTPKEEAQALEDLTGFKELFQTPGHTEEAVAAGKTTKMPCESSPPES
ADTPTSTRRQPKTPLEKRDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7SY83	0.074	0.071	5.431E-8	1477	0.150	0.142	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
2	PDB:2ff4A	0.064	0.233	1.150E-7	379	0.019	0.069	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
3	AFDB:Q14676	0.084	0.058	3.727E-7	2089	0.183	0.123	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
4	PDB:7dvqX	0.067	0.558	4.738E-7	156	0.020	0.179	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
5	AFDB:Q5PSV9	0.071	0.059	8.236E-7	1707	0.151	0.124	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
6	PDB:5gm6U	0.066	0.481	1.557E-6	176	0.020	0.159	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
7	AFDB:Q6A065	0.074	0.066	1.820E-6	1588	0.152	0.134	Q6A065.pdb.gz	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2
8	AFDB:Q95RC8	0.074	0.081	3.207E-6	1280	0.108	0.118	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
9	PDB:2kb3A	0.064	0.576	3.251E-6	143	0.019	0.189	2kb3A.pdb.gz
10	PDB:5z56X	0.067	0.540	2.108E-5	159	0.018	0.157	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
11	PDB:7wrgA	0.068	0.115	4.658E-5	812	0.009	0.015	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	AFDB:Q5SW79	0.067	0.060	8.098E-5	1584	0.154	0.136	Q5SW79.pdb.gz	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
13	AFDB:O96685	0.067	0.073	9.069E-5	1261	0.116	0.129	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
14	AFDB:Q9Y4F5	0.066	0.059	2.376E-4	1589	0.147	0.130	Q9Y4F5.pdb.gz	C170B_HUMAN Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B PE=1 SV=4
15	PDB:2kfuA	0.063	0.474	2.697E-4	162	0.016	0.142	2kfuA.pdb.gz
16	PDB:7wrgB	0.066	0.115	4.243E-4	783	0.008	0.014	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
17	PDB:6l9wD	0.048	0.422	6.434E-3	142	0.009	0.092	6l9wD.pdb.gz
18	AFDB:F1M078	0.032	0.037	1.971E-2	1164	0.111	0.134	F1M078.pdb.gz	F1M078_RAT Zinc finger protein 804A OS=Rattus norvegicus OX=10116 GN=Zfp804a PE=4 SV=4
19	AFDB:M9PHA0	0.032	0.034	1.971E-2	1305	0.134	0.143	M9PHA0.pdb.gz	M9PHA0_DROME Bifocal, isoform F OS=Drosophila melanogaster OX=7227 GN=bif PE=1 SV=1
20	PDB:1u0rD	0.042	0.162	8.886E-1	301	0.007	0.033	1u0rD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A0Y6	0.0	1108	3121	0.507	0.227	D4A0Y6_RAT Marker of proliferation Ki-67 OS=Rattus norvegicus OX=10116 GN=Mki67 PE=1 SV=3
2	E9PVX6	0.0	1112	3177	0.509	0.224	KI67_MOUSE Proliferation marker protein Ki-67 OS=Mus musculus OX=10090 GN=Mki67 PE=1 SV=1
3	P46013	0.0	2880	3256	1.000	0.430	KI67_HUMAN Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2
4	Q69YH5	1.80e-05	52.0	1023	0.018	0.024	CDCA2_HUMAN Cell division cycle-associated protein 2 OS=Homo sapiens OX=9606 GN=CDCA2 PE=1 SV=2
5	E9PEI0	1.81e-05	52.0	1008	0.018	0.025	E9PEI0_HUMAN Cell division cycle associated 2 OS=Homo sapiens OX=9606 GN=CDCA2 PE=1 SV=1
6	Q14B71	2.42e-05	51.6	982	0.021	0.030	CDCA2_MOUSE Cell division cycle-associated protein 2 OS=Mus musculus OX=10090 GN=Cdca2 PE=1 SV=2
7	A0A1U9XBC1	3.59e-04	47.8	2089	0.023	0.015	A0A1U9XBC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 PE=4 SV=1
8	Q14676	3.59e-04	47.8	2089	0.023	0.015	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
9	Q5PSV9	0.001	45.8	1707	0.023	0.019	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
10	P71590	0.002	45.1	527	0.019	0.051	FHAA_MYCTU FHA domain-containing protein FhaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fhaA PE=1 SV=1
11	E9Q585	0.015	42.4	715	0.019	0.036	E9Q585_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
12	Q3UUI2	0.015	42.0	536	0.019	0.049	Q3UUI2_MOUSE FHA domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
13	E9PX68	0.016	42.0	744	0.019	0.035	E9PX68_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
14	E9Q1Q0	0.017	42.0	534	0.019	0.049	E9Q1Q0_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
15	Q6GQW1	0.017	42.0	537	0.019	0.048	Q6GQW1_MOUSE Slc4a1ap protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
16	Q9M8A0	0.081	39.7	585	0.020	0.048	Q9M8A0_ARATH F16B3.3 protein OS=Arabidopsis thaliana OX=3702 GN=FHA3 PE=1 SV=1
17	Q8NQJ3	0.14	37.0	143	0.016	0.161	ODHI_CORGL Oxoglutarate dehydrogenase inhibitor OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=odhI PE=1 SV=1
18	P9WJA9	0.17	37.0	162	0.019	0.160	GARA_MYCTU Glycogen accumulation regulator GarA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=garA PE=1 SV=1
19	Q9NQT8	0.22	38.5	1826	0.022	0.017	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
20	Q86L04	0.32	37.7	711	0.017	0.034	TRAP1_DICDI TNF receptor-associated protein 1 homolog, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=trap1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	2.1e-11	55.3	FHA domain
2	PF08065 KI67R	1.3e-144	484.7	KI67R (NUC007) repeat
3	PF15276 PP1_bind	5.2e-10	50.7	Protein phosphatase 1 binding
4	PF16697 Yop-YscD_cpl	7.3e-05	34.3	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000285814	0.994	Nucleolar protein interacting with the FHA domain of MKI67
2	9606.ENSP00000411532	0.988	DNA topoisomerase 2-alpha
3	9606.ENSP00000356379	0.985	Abnormal spindle-like microcephaly-associated protein
4	9606.ENSP00000265148	0.981	Centromere-associated protein E
5	9606.ENSP00000324020	0.980	Kinesin-like protein KIF15
6	9606.ENSP00000453403	0.980	Nucleolar and spindle-associated protein 1
7	9606.ENSP00000247191	0.975	Disks large-associated protein 5
8	9606.ENSP00000260731	0.975	Kinesin-like protein KIF11
9	9606.ENSP00000302530	0.975	Mitotic checkpoint serine/threonine-protein kinase BUB1
10	9606.ENSP00000355922	0.975	Centromere protein F
11	9606.ENSP00000361540	0.972	Cell division cycle protein 20 homolog
12	9606.ENSP00000342307	0.971	Forkhead box protein M1
13	9606.ENSP00000353770	0.967	Ribonucleoside-diphosphate reductase subunit M2
14	9606.ENSP00000287598	0.959	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
15	9606.ENSP00000378356	0.959	Kinesin-like protein KIF20A
16	9606.ENSP00000378699	0.959	Cyclin-dependent kinase 1
17	9606.ENSP00000274026	0.957	Cyclin-A2
18	9606.ENSP00000358813	0.957	Dual specificity protein kinase TTK
19	9606.ENSP00000360540	0.957	Centrosomal protein of 55 kDa
20	9606.ENSP00000362146	0.946	Borealin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008283	0.998	cell population proliferation
GO:0051726	0.946	regulation of cell cycle
GO:0051128	0.895	regulation of cellular component organization
GO:0051783	0.885	regulation of nuclear division
GO:0010564	0.878	regulation of cell cycle process
GO:0051983	0.639	regulation of chromosome segregation
GO:0007346	0.434	regulation of mitotic cell cycle
GO:0007088	0.399	regulation of mitotic nuclear division

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0031981	0.994	nuclear lumen
GO:0005694	0.987	chromosome
GO:0005654	0.979	nucleoplasm
GO:0000793	0.937	condensed chromosome
GO:0016020	0.898	membrane
GO:0005737	0.791	cytoplasm
GO:0005730	0.734	nucleolus
GO:0016604	0.425	nuclear body
GO:0005829	0.365	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]