StarFunc result for job id P46019

User Input

>input (1235 residues)
MRSRSNSGVRLDGYARLVQQTILCYQNPVTGLLSASHEQKDAWVRDNIYSILAVWGLGMA
YRKNADRDEDKAKAYELEQNVVKLMRGLLQCMMRQVAKVEKFKHTQSTKDSLHAKYNTAT
CGTVVGDDQWGHLQVDATSLFLLFLAQMTASGLRIIFTLDEVAFIQNLVFYIEAAYKVAD
YGMWERGDKTNQGIPELNASSVGMAKAALEAIDELDLFGAHGGRKSVIHVLPDEVEHCQS
ILFSMLPRASTSKEIDAGLLSIISFPAFAVEDVNLVNVTKNEIISKLQGRYGCCRFLRDG
YKTPREDPNRLHYDPAELKLFENIECEWPVFWTYFIIDGVFSGDAVQVQEYREALEGILI
RGKNGIRLVPELYAVPPNKVDEEYKNPHTVDRVPMGKVPHLWGQSLYILSSLLAEGFLAA
GEIDPLNRRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILS
HIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFTPQFTDQHHFYLALDNEMIV
EMLRIELAYLCTCWRMTGRPTLTFPISRTMLTNDGSDIHSAVLSTIRKLEDGYFGGARVK
LGNLSEFLTTSFYTYLTFLDPDCDEKLFDNASEGTFSPDSDSDLVGYLEDTCNQESQDEL
DHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVPFVPMTLPT
KVLSAHRKSLNLVDSPQPLLEKVPESDFQWPRDDHGDVDCEKLVEQLKDCSNLQDQADIL
YILYVIKGPSWDTNLSGQHGVTVQNLLGELYGKAGLNQEWGLIRYISGLLRKKVEVLAEA
CTDLLSHQKQLTVGLPPEPREKIISAPLPPEELTKLIYEASGQDISIAVLTQEIVVYLAM
YVRAQPSLFVEMLRLRIGLIIQVMATELARSLNCSGEEASESLMNLSPFDMKNLLHHILS
GKEFGVERSVRPIHSSTSSPTISIHEVGHTGVTKTERSGINRLRSEMKQMTRRFSADEQF
FSVGQAASSSAHSSKSARSSTPSSPTGTSSSDSGGHHIGWGERQGQWLRRRRLDGAINRV
PVGFYQRVWKILQKCHGLSIDGYVLPSSTTREMTPHEIKFAVHVESVLNRVPQPEYRQLL
VEAIMVLTLLSDTEMTSIGGIIHVDQIVQMASQLFLQDQVSIGAMDTLEKDQATGICHFF
YDSAPSGAYGTMTYLTRAVASYLQELLPNSGCQMQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46019	1.000	1.000	0.000	1235	1.000	1.000	P46019.pdb.gz	KPB2_HUMAN Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1
2	AFDB:Q64649	0.887	0.882	0.000	1242	0.681	0.677	Q64649.pdb.gz	KPB1_RAT Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Rattus norvegicus OX=10116 GN=Phka1 PE=1 SV=2
3	AFDB:Q93100	0.762	0.859	5.582E-80	1093	0.317	0.359	Q93100.pdb.gz	KPBB_HUMAN Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB PE=1 SV=3
4	AFDB:Q5RKH5	0.732	0.819	4.890E-77	1100	0.304	0.342	Q5RKH5.pdb.gz	Q5RKH5_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
5	PDB:6frvA	0.211	0.484	2.063E-4	467	0.053	0.141	6frvA.pdb.gz	Structural insight into industrially relevant glucoamylases: flexible positions of starch-binding domains.
6	PDB:6ttjC	0.208	0.501	4.613E-4	441	0.053	0.150	6ttjC.pdb.gz
7	PDB:3qryB	0.209	0.511	6.934E-3	426	0.049	0.143	3qryB.pdb.gz	Analysis of a New Family of Widely Distributed Metal-independent {alpha}-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans.
8	PDB:1fp3A	0.195	0.468	7.547E-3	402	0.043	0.132	1fp3A.pdb.gz
9	PDB:2rgkA	0.169	0.411	1.015E-2	409	0.047	0.142	2rgkA.pdb.gz
10	PDB:6trhC	0.144	0.348	1.886E-1	385	0.041	0.132	6trhC.pdb.gz	Structural analysis of the reducing-end xylose-releasing exo-oligoxylanase Rex8A from Paenibacillus barcinonensis BP-23 deciphers its molecular specificity.
11	PDB:1ut9A	0.145	0.248	2.646E-1	605	0.046	0.094	1ut9A.pdb.gz
12	AFDB:Q9CX83	0.072	0.147	3.144E-1	456	0.048	0.129	Q9CX83.pdb.gz	ARMX1_MOUSE Armadillo repeat-containing X-linked protein 1 OS=Mus musculus OX=10090 GN=Armcx1 PE=1 SV=1
13	AFDB:Q9XVI2	0.079	0.091	6.738E-1	811	0.050	0.076	Q9XVI2.pdb.gz	Q9XVI2_CAEEL SYmmetrical Sister cell hermaphrodite gonad defect OS=Caenorhabditis elegans OX=6239 GN=sys-1 PE=1 SV=1
14	PDB:3qxqA	0.133	0.379	7.009E-1	338	0.029	0.107	3qxqA.pdb.gz	Apo- and cellopentaose-bound structures of the bacterial cellulose synthase subunit BcsZ.
15	AFDB:P39935	0.071	0.082	7.334E-1	952	0.054	0.070	P39935.pdb.gz	IF4F1_YEAST Eukaryotic initiation factor 4F subunit p150 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF4631 PE=1 SV=2
16	PDB:6zqaUB	0.060	0.123	9.427E-1	504	0.039	0.095	6zqaUB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
17	PDB:7eawA	0.156	0.297	9.427E-1	560	0.041	0.091	7eawA.pdb.gz	pH-dependent alteration of substrate specificity of plant trehalase and its molecular mechanism
18	AFDB:P39936	0.072	0.089	9.864E-1	914	0.054	0.073	P39936.pdb.gz	IF4F2_YEAST Eukaryotic initiation factor 4F subunit p130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF4632 PE=1 SV=1
19	AFDB:Q4Q6K0	0.067	0.073	1.120	1010	0.049	0.059	Q4Q6K0.pdb.gz	Q4Q6K0_LEIMA Mitochondrial RNA binding complex 1 subunit OS=Leishmania major OX=5664 GN=LMJF_31_0630 PE=4 SV=1
20	AFDB:F4JZ68	0.053	0.057	2.301	1063	0.040	0.047	F4JZ68.pdb.gz	KN7H_ARATH Kinesin-like protein KIN-7H OS=Arabidopsis thaliana OX=3702 GN=KIN7H PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZLG9	0.0	2310	1207	0.899	0.920	A0A8I5ZLG9_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phka2 PE=1 SV=1
2	A0A8I5ZWF0	0.0	2334	1217	0.905	0.919	A0A8I5ZWF0_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phka2 PE=1 SV=1
3	A0A8I6A710	0.0	2234	1190	0.873	0.906	A0A8I6A710_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=AABR07037995.1 PE=1 SV=1
4	F1M1C9	0.0	1048	538	0.402	0.924	F1M1C9_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=AABR07037995.1 PE=1 SV=4
5	P46019	0.0	2570	1235	1.000	1.000	KPB2_HUMAN Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1
6	P46020	0.0	1725	1223	0.691	0.698	KPB1_HUMAN Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1 PE=1 SV=2
7	Q64649	0.0	1686	1242	0.683	0.679	KPB1_RAT Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Rattus norvegicus OX=10116 GN=Phka1 PE=1 SV=2
8	A0A0G2K9C8	1.27e-145	470	1085	0.213	0.242	A0A0G2K9C8_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
9	A0A8J8YFM3	1.65e-145	470	1093	0.213	0.241	A0A8J8YFM3_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
10	Q93100	2.14e-145	469	1093	0.215	0.242	KPBB_HUMAN Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB PE=1 SV=3
11	A0A8I5Y5Q0	2.19e-145	469	1079	0.213	0.244	A0A8I5Y5Q0_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
12	Q5RKH5	2.22e-145	470	1100	0.212	0.238	Q5RKH5_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
13	A0A8I5ZXC2	2.78e-141	457	1034	0.207	0.248	A0A8I5ZXC2_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
14	O64631	0.52	37.0	511	0.021	0.051	O64631_ARATH At2g45510 OS=Arabidopsis thaliana OX=3702 GN=CYP704A2 PE=1 SV=1
15	Q9FJT7	0.96	35.8	346	0.019	0.069	NDL1_ARATH Protein NDL1 OS=Arabidopsis thaliana OX=3702 GN=NDL1 PE=1 SV=1
16	P42695	1.9	35.4	1498	0.020	0.017	CNDD3_HUMAN Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2
17	P57720	2.6	34.7	436	0.026	0.073	AROC_ARATH Chorismate synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB1144 PE=2 SV=2
18	O14273	3.5	34.3	647	0.022	0.042	YET4_SCHPO Meiotically up-regulated protein C8C9.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC8C9.04 PE=1 SV=1
19	Q7XJ96	3.7	33.9	471	0.022	0.057	DRC4_CHLRE Dynein regulatory complex subunit 4 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC4 PE=1 SV=1
20	E9Q6D6	6.8	33.1	583	0.016	0.034	ZN277_MOUSE Zinc finger protein 277 OS=Mus musculus OX=10090 GN=Znf277 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00723 Glyco_hydro_15	8.6e-193	652.8	Glycosyl hydrolases family 15
2	PF19292 KPBB_C	1.8e-26	104.4	Phosphorylase b kinase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369274

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000455607	0.998	Phosphorylase b kinase gamma catalytic chain, liver/testis isoform
2	9606.ENSP00000216392	0.949	Glycogen phosphorylase, liver form
3	9606.ENSP00000313504	0.929	Phosphorylase b kinase regulatory subunit beta
4	9606.ENSP00000445440	0.925	Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
5	9606.ENSP00000272298	0.870	Calmodulin 2 (phosphorylase kinase, delta)
6	9606.ENSP00000291295	0.822	Calmodulin 3 (phosphorylase kinase, delta)
7	9606.ENSP00000304643	0.822	Calmodulin-like protein 6
8	9606.ENSP00000315299	0.822	Calmodulin-like protein 3
9	9606.ENSP00000349467	0.822	Calmodulin-1
10	9606.ENSP00000369689	0.822	Calmodulin-like protein 5
11	9606.ENSP00000419081	0.822	Calmodulin-like protein 4
12	9606.ENSP00000362643	0.806	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
13	9606.ENSP00000164139	0.721	Glycogen phosphorylase, muscle form
14	9606.ENSP00000216962	0.700	Glycogen phosphorylase, brain form
15	9606.ENSP00000379503	0.690	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
16	9606.ENSP00000388137	0.681	Metallophosphoesterase domain-containing protein 1
17	9606.ENSP00000326031	0.657	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
18	9606.ENSP00000341779	0.656	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
19	9606.ENSP00000344277	0.640	Docking protein 4
20	9606.ENSP00000405573	0.640	Glucose-6-phosphate isomerase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004683	1.000	calmodulin-dependent protein kinase activity
GO:0004689	0.960	phosphorylase kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	1.000	organic substance metabolic process
GO:0044237	1.000	cellular metabolic process
GO:0044238	0.999	primary metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:1901564	0.956	organonitrogen compound metabolic process
GO:0019538	0.938	protein metabolic process
GO:0036211	0.930	protein modification process
GO:0006796	0.706	phosphate-containing compound metabolic process
GO:0006091	0.678	generation of precursor metabolites and energy
GO:0005975	0.524	carbohydrate metabolic process
GO:0016310	0.433	phosphorylation
GO:0006468	0.309	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:1902554	0.998	serine/threonine protein kinase complex
GO:0005829	0.981	cytosol
GO:0005964	0.720	phosphorylase kinase complex
GO:0043227	0.489	membrane-bounded organelle
GO:0043231	0.461	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.17	1.000	calcium/calmodulin-dependent protein kinase.
EC:2.7.11.19	0.960	phosphorylase kinase.

[back to server]