StarFunc result for job id P46020

User Input

>input (1223 residues)
MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLA
YRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKT
CATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTAD
FGIWERGDKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQS
ILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTKQEIITKLQGRYGCCRFLRDG
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQEYKEALEAVLI
KGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILS
HIYSSLGCNNRMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIV
EMLRTDLSYLCSRWRMTGQPTITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQ
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDDNYDYLESGNWMNDYDSTSHARCGDEV
ARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPT
KLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQA
DILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVY
LAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHH
ILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSIS
AESQSPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFYQKVWKVLQ
KCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADI
EIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYDSAPSGRFGTM
TYLSKAAATYVQEFLPHSICAMQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46019	0.862	0.853	0.000	1235	0.697	0.690	P46019.pdb.gz	KPB2_HUMAN Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1
2	AFDB:Q64649	0.914	0.901	0.000	1242	0.936	0.922	Q64649.pdb.gz	KPB1_RAT Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Rattus norvegicus OX=10116 GN=Phka1 PE=1 SV=2
3	AFDB:Q93100	0.771	0.861	1.412E-76	1093	0.308	0.345	Q93100.pdb.gz	KPBB_HUMAN Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB PE=1 SV=3
4	AFDB:Q5RKH5	0.727	0.805	1.899E-73	1100	0.302	0.335	Q5RKH5.pdb.gz	Q5RKH5_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
5	PDB:6frvA	0.212	0.490	5.510E-5	467	0.052	0.135	6frvA.pdb.gz	Structural insight into industrially relevant glucoamylases: flexible positions of starch-binding domains.
6	PDB:2rgkA	0.192	0.467	4.017E-3	409	0.041	0.122	2rgkA.pdb.gz
7	PDB:3qryB	0.202	0.482	4.365E-3	426	0.056	0.162	3qryB.pdb.gz	Analysis of a New Family of Widely Distributed Metal-independent {alpha}-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans.
8	PDB:6ttjC	0.215	0.503	6.902E-3	441	0.044	0.122	6ttjC.pdb.gz
9	PDB:1fp3A	0.197	0.474	8.499E-3	402	0.036	0.109	1fp3A.pdb.gz
10	PDB:6vptA	0.096	0.188	1.504E-1	483	0.046	0.116	6vptA.pdb.gz
11	PDB:6trhC	0.133	0.327	2.188E-1	385	0.041	0.130	6trhC.pdb.gz	Structural analysis of the reducing-end xylose-releasing exo-oligoxylanase Rex8A from Paenibacillus barcinonensis BP-23 deciphers its molecular specificity.
12	PDB:7qenD	0.091	0.102	2.809E-1	1050	0.095	0.110	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
13	PDB:3aniA	0.142	0.349	3.459E-1	378	0.039	0.127	3aniA.pdb.gz
14	AFDB:Q95YF0	0.087	0.080	3.511E-1	1378	0.104	0.092	Q95YF0.pdb.gz	CLAP1_CAEEL Protein CLASP-1 OS=Caenorhabditis elegans OX=6239 GN=cls-1 PE=3 SV=1
15	AFDB:Q63120	0.059	0.052	3.816E-1	1541	0.103	0.082	Q63120.pdb.gz	MRP2_RAT ATP-binding cassette sub-family C member 2 OS=Rattus norvegicus OX=10116 GN=Abcc2 PE=1 SV=1
16	PDB:7q1yA	0.168	0.152	3.919E-1	1374	0.043	0.038	7q1yA.pdb.gz
17	AFDB:E9PQ02	0.047	0.181	1.037	189	0.019	0.122	E9PQ02.pdb.gz	E9PQ02_HUMAN Kinesin light chain (Fragment) OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1
18	AFDB:Q9NP59	0.060	0.096	1.572	571	0.051	0.109	Q9NP59.pdb.gz	S40A1_HUMAN Solute carrier family 40 member 1 OS=Homo sapiens OX=9606 GN=SLC40A1 PE=1 SV=1
19	AFDB:B5MEV3	0.062	0.104	1.639	450	0.038	0.102	B5MEV3.pdb.gz	S52A2_RAT Solute carrier family 52, riboflavin transporter, member 2 OS=Rattus norvegicus OX=10116 GN=Slc52a2 PE=2 SV=2
20	AFDB:Q8T145	0.033	0.026	1.639	1789	0.044	0.030	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZLG9	0.0	1728	1207	0.688	0.697	A0A8I5ZLG9_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phka2 PE=1 SV=1
2	A0A8I5ZWF0	0.0	1736	1217	0.686	0.689	A0A8I5ZWF0_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phka2 PE=1 SV=1
3	A0A8I6A710	0.0	1657	1190	0.662	0.681	A0A8I6A710_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=AABR07037995.1 PE=1 SV=1
4	F1M1C9	0.0	920	538	0.348	0.792	F1M1C9_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=AABR07037995.1 PE=1 SV=4
5	P46019	0.0	1719	1235	0.696	0.689	KPB2_HUMAN Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1
6	P46020	0.0	2546	1223	1.000	1.000	KPB1_HUMAN Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1 PE=1 SV=2
7	Q64649	0.0	2328	1242	0.932	0.918	KPB1_RAT Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Rattus norvegicus OX=10116 GN=Phka1 PE=1 SV=2
8	Q93100	1.82e-152	488	1093	0.216	0.242	KPBB_HUMAN Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB PE=1 SV=3
9	A0A0G2K9C8	2.86e-152	488	1085	0.215	0.242	A0A0G2K9C8_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
10	Q5RKH5	3.58e-152	488	1100	0.218	0.243	Q5RKH5_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
11	A0A8I5Y5Q0	3.96e-152	487	1079	0.218	0.247	A0A8I5Y5Q0_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
12	A0A8J8YFM3	4.36e-152	487	1093	0.215	0.241	A0A8J8YFM3_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
13	A0A8I5ZXC2	6.44e-148	474	1034	0.210	0.249	A0A8I5ZXC2_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
14	Q9VWZ3	5.6	33.9	4081	0.025	0.007	Q9VWZ3_DROME Dynein heavy chain at 16F OS=Drosophila melanogaster OX=7227 GN=Dhc16F PE=3 SV=1
15	Q9FJT7	6.0	33.1	346	0.018	0.064	NDL1_ARATH Protein NDL1 OS=Arabidopsis thaliana OX=3702 GN=NDL1 PE=1 SV=1
16	Q8IIJ2	7.2	33.1	561	0.016	0.034	Q8IIJ2_PLAF7 Tyrosine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1117500 PE=3 SV=2
17	Q46896	8.4	32.7	305	0.016	0.066	CAS1_ECOLI CRISPR-associated endonuclease Cas1 OS=Escherichia coli (strain K12) OX=83333 GN=ygbT PE=1 SV=1
18	Q7XJ96	9.6	32.7	471	0.025	0.064	DRC4_CHLRE Dynein regulatory complex subunit 4 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00723 Glyco_hydro_15	1.3e-191	649.0	Glycosyl hydrolases family 15
2	PF19292 KPBB_C	2.4e-23	94.1	Phosphorylase b kinase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000455607	0.996	Phosphorylase b kinase gamma catalytic chain, liver/testis isoform
2	9606.ENSP00000445440	0.967	Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
3	9606.ENSP00000164139	0.962	Glycogen phosphorylase, muscle form
4	9606.ENSP00000216962	0.947	Glycogen phosphorylase, brain form
5	9606.ENSP00000313504	0.902	Phosphorylase b kinase regulatory subunit beta
6	9606.ENSP00000272298	0.901	Calmodulin 2 (phosphorylase kinase, delta)
7	9606.ENSP00000349467	0.876	Calmodulin-1
8	9606.ENSP00000304643	0.831	Calmodulin-like protein 6
9	9606.ENSP00000315299	0.822	Calmodulin-like protein 3
10	9606.ENSP00000369689	0.822	Calmodulin-like protein 5
11	9606.ENSP00000419081	0.822	Calmodulin-like protein 4
12	9606.ENSP00000369274	0.806	Phosphorylase b kinase regulatory subunit alpha, liver isoform
13	9606.ENSP00000216392	0.796	Glycogen phosphorylase, liver form
14	9606.ENSP00000343331	0.786	Lipase member I
15	9606.ENSP00000291295	0.770	Calmodulin 3 (phosphorylase kinase, delta)
16	9606.ENSP00000362744	0.768	Ribosomal protein S4, X-linked
17	9606.ENSP00000238994	0.699	Protein phosphatase 1 regulatory subunit 3C
18	9606.ENSP00000309591	0.675	cAMP-dependent protein kinase catalytic subunit alpha
19	9606.ENSP00000284601	0.667	Protein phosphatase 1 regulatory subunit 3A
20	9606.ENSP00000388137	0.658	Metallophosphoesterase domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004683	1.000	calmodulin-dependent protein kinase activity
GO:0005515	0.998	protein binding
GO:0070567	0.682	cytidylyltransferase activity
GO:0004689	0.662	phosphorylase kinase activity
GO:0004105	0.341	choline-phosphate cytidylyltransferase activity
GO:0016787	0.326	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0009987	0.998	cellular process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0043170	0.974	macromolecule metabolic process
GO:1901564	0.886	organonitrogen compound metabolic process
GO:0019538	0.881	protein metabolic process
GO:0036211	0.792	protein modification process
GO:0006796	0.429	phosphate-containing compound metabolic process
GO:0005975	0.380	carbohydrate metabolic process
GO:0006468	0.369	protein phosphorylation
GO:0006091	0.306	generation of precursor metabolites and energy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:1902494	0.998	catalytic complex
GO:0005829	0.988	cytosol
GO:1902554	0.985	serine/threonine protein kinase complex
GO:0005964	0.680	phosphorylase kinase complex
GO:0070013	0.511	intracellular organelle lumen
GO:0043227	0.489	membrane-bounded organelle
GO:0005634	0.472	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.17	1.000	calcium/calmodulin-dependent protein kinase.
EC:2.7.7.-	0.682	Nucleotidyltransferases.
EC:2.7.11.19	0.662	phosphorylase kinase.
RHEA:18997	0.341	CTP + H(+) + phosphocholine = CDP-choline + diphosphate
EC:2.7.7.15	0.341	choline-phosphate cytidylyltransferase.
EC:3.-.-.-	0.326	Hydrolases.

[back to server]