StarFunc result for job id P46098

User Input

>input (478 residues)
MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46098	1.000	1.000	3.354E-87	478	1.000	1.000	P46098.pdb.gz	5HT3A_HUMAN 5-hydroxytryptamine receptor 3A OS=Homo sapiens OX=9606 GN=HTR3A PE=1 SV=1
2	AFDB:O70212	0.860	0.839	2.583E-76	490	0.835	0.814	O70212.pdb.gz	5HT3A_CAVPO 5-hydroxytryptamine receptor 3A OS=Cavia porcellus OX=10141 GN=HTR3A PE=2 SV=1
3	AFDB:P23979	0.878	0.863	1.764E-74	487	0.818	0.803	P23979.pdb.gz	5HT3A_MOUSE 5-hydroxytryptamine receptor 3A OS=Mus musculus OX=10090 GN=Htr3a PE=1 SV=2
4	AFDB:Q9JHJ5	0.726	0.791	1.160E-47	437	0.408	0.446	Q9JHJ5.pdb.gz	5HT3B_MOUSE 5-hydroxytryptamine receptor 3B OS=Mus musculus OX=10090 GN=Htr3b PE=2 SV=1
5	AFDB:O95264	0.698	0.753	2.670E-47	441	0.395	0.429	O95264.pdb.gz	5HT3B_HUMAN 5-hydroxytryptamine receptor 3B OS=Homo sapiens OX=9606 GN=HTR3B PE=1 SV=1
6	AFDB:A5X5Y0	0.699	0.730	1.620E-40	456	0.345	0.362	A5X5Y0.pdb.gz	5HT3E_HUMAN 5-hydroxytryptamine receptor 3E OS=Homo sapiens OX=9606 GN=HTR3E PE=1 SV=1
7	AFDB:Q8WXA8	0.675	0.720	7.679E-40	447	0.320	0.342	Q8WXA8.pdb.gz	5HT3C_HUMAN 5-hydroxytryptamine receptor 3C OS=Homo sapiens OX=9606 GN=HTR3C PE=1 SV=2
8	AFDB:F1P4Y5	0.771	0.736	1.266E-39	502	0.299	0.285	F1P4Y5.pdb.gz
9	AFDB:Q03481	0.780	0.732	3.258E-39	511	0.278	0.260	Q03481.pdb.gz	Q03481_CHICK Alpha8 subunit of nicotinic acetylcholine receptor OS=Gallus gallus OX=9031 GN=CHRNA8 PE=2 SV=1
10	AFDB:Q9PTS8	0.771	0.762	3.258E-39	484	0.262	0.258	Q9PTS8.pdb.gz	ACHA9_CHICK Neuronal acetylcholine receptor subunit alpha-9 OS=Gallus gallus OX=9031 GN=CHRNA9 PE=1 SV=1
11	PDB:6i53A	0.545	0.735	4.007E-22	349	0.157	0.215	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:6i53B	0.556	0.773	2.244E-21	338	0.142	0.201	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:4aq5E	0.607	0.762	8.589E-19	370	0.192	0.249	4aq5E.pdb.gz
14	PDB:4hfcA	0.506	0.753	2.336E-18	311	0.100	0.154	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7kuyE	0.482	0.666	2.610E-18	338	0.121	0.172	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
16	PDB:2w8gC	0.402	0.859	7.505E-18	217	0.088	0.194	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
17	PDB:4afhA	0.374	0.795	6.404E-16	213	0.100	0.225	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:7l6qA	0.473	0.709	1.558E-15	311	0.107	0.164	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.444	0.711	5.508E-12	288	0.117	0.194	6zgdA.pdb.gz
20	PDB:7rwaM	0.092	0.109	5.555E-3	379	0.071	0.090	7rwaM.pdb.gz	Structural basis of an endocytic checkpoint that primes the AP2 clathrin adaptor for cargo internalization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70212	0.0	788	490	0.843	0.822	5HT3A_CAVPO 5-hydroxytryptamine receptor 3A OS=Cavia porcellus OX=10141 GN=HTR3A PE=2 SV=1
2	P23979	0.0	819	487	0.849	0.834	5HT3A_MOUSE 5-hydroxytryptamine receptor 3A OS=Mus musculus OX=10090 GN=Htr3a PE=1 SV=2
3	P35563	0.0	828	483	0.849	0.841	5HT3A_RAT 5-hydroxytryptamine receptor 3A OS=Rattus norvegicus OX=10116 GN=Htr3a PE=1 SV=2
4	P46098	0.0	978	478	1.000	1.000	5HT3A_HUMAN 5-hydroxytryptamine receptor 3A OS=Homo sapiens OX=9606 GN=HTR3A PE=1 SV=1
5	O95264	7.31e-123	367	441	0.406	0.440	5HT3B_HUMAN 5-hydroxytryptamine receptor 3B OS=Homo sapiens OX=9606 GN=HTR3B PE=1 SV=1
6	Q9JHJ5	2.06e-121	363	437	0.400	0.437	5HT3B_MOUSE 5-hydroxytryptamine receptor 3B OS=Mus musculus OX=10090 GN=Htr3b PE=2 SV=1
7	Q9JJ16	1.13e-119	359	437	0.395	0.432	5HT3B_RAT 5-hydroxytryptamine receptor 3B OS=Rattus norvegicus OX=10116 GN=Htr3b PE=1 SV=1
8	A5X5Y0	4.55e-94	294	456	0.349	0.366	5HT3E_HUMAN 5-hydroxytryptamine receptor 3E OS=Homo sapiens OX=9606 GN=HTR3E PE=1 SV=1
9	Q8WXA8	1.13e-89	282	447	0.337	0.360	5HT3C_HUMAN 5-hydroxytryptamine receptor 3C OS=Homo sapiens OX=9606 GN=HTR3C PE=1 SV=2
10	Q9GZZ6	4.68e-73	239	450	0.293	0.311	ACH10_HUMAN Neuronal acetylcholine receptor subunit alpha-10 OS=Homo sapiens OX=9606 GN=CHRNA10 PE=1 SV=1
11	Q9JLB5	2.72e-71	234	447	0.285	0.304	ACH10_RAT Neuronal acetylcholine receptor subunit alpha-10 OS=Rattus norvegicus OX=10116 GN=Chrna10 PE=1 SV=1
12	B2RX82	3.44e-70	232	447	0.285	0.304	B2RX82_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 10 OS=Mus musculus OX=10090 GN=Chrna10 PE=2 SV=1
13	P20420	2.22e-68	227	452	0.276	0.292	ACHA5_RAT Neuronal acetylcholine receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Chrna5 PE=1 SV=1
14	Q2MKA5	1.20e-67	226	467	0.266	0.272	ACHA5_MOUSE Neuronal acetylcholine receptor subunit alpha-5 OS=Mus musculus OX=10090 GN=Chrna5 PE=2 SV=1
15	P26152	1.96e-67	225	454	0.264	0.278	ACHA5_CHICK Neuronal acetylcholine receptor subunit alpha-5 OS=Gallus gallus OX=9031 GN=CHRNA5 PE=1 SV=2
16	Q9I8C7	7.43e-67	223	452	0.310	0.327	ACH10_CHICK Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1
17	Q9R0W9	1.16e-65	221	494	0.259	0.251	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
18	P22770	2.20e-65	221	502	0.299	0.285	ACHA7_CHICK Neuronal acetylcholine receptor subunit alpha-7 OS=Gallus gallus OX=9031 GN=CHRNA7 PE=1 SV=1
19	Q8BMN3	4.18e-64	216	464	0.280	0.289	ACHB3_MOUSE Neuronal acetylcholine receptor subunit beta-3 OS=Mus musculus OX=10090 GN=Chrnb3 PE=2 SV=1
20	Q05901	6.79e-64	216	458	0.276	0.288	ACHB3_HUMAN Neuronal acetylcholine receptor subunit beta-3 OS=Homo sapiens OX=9606 GN=CHRNB3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	1.2e-52	190.0	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	8.8e-38	142.3	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000004457

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000004456	0.718	5-hydroxytryptamine (serotonin) receptor 3B, ionotropic
2	9601.ENSPPYP00000004028	0.701	RIC3 acetylcholine receptor chaperone
3	9601.ENSPPYP00000002068	0.599	5-hydroxytryptamine (serotonin) receptor 6, G protein-coupled
4	9601.ENSPPYP00000006095	0.577	Pongo abelii 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled (HTR2A), mRNA
5	9601.ENSPPYP00000017318	0.576	5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
6	9601.ENSPPYP00000002020	0.572	5-hydroxytryptamine (serotonin) receptor 1D, G protein-coupled
7	9601.ENSPPYP00000002864	0.569	5-hydroxytryptamine (serotonin) receptor 7, adenylate cyclase-coupled
8	9601.ENSPPYP00000009269	0.554	Uncharacterized protein
9	9601.ENSPPYP00000016039	0.551	5-hydroxytryptamine (serotonin) receptor 3E, ionotropic
10	9601.ENSPPYP00000016179	0.551	Uncharacterized protein
11	9601.ENSPPYP00000020418	0.547	5-hydroxytryptamine (serotonin) receptor 5A, G protein-coupled
12	9601.ENSPPYP00000016037	0.536	Uncharacterized protein
13	9601.ENSPPYP00000016098	0.534	Somatostatin
14	9601.ENSPPYP00000017818	0.534	5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled
15	9601.ENSPPYP00000004926	0.532	Uncharacterized protein
16	9601.ENSPPYP00000018790	0.532	5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled
17	9601.ENSPPYP00000016038	0.530	Uncharacterized protein
18	9601.ENSPPYP00000023110	0.528	5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled
19	9601.ENSPPYP00000009141	0.523	Transporter
20	9601.ENSPPYP00000013141	0.518	Parvalbumin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0099589	1.000	serotonin receptor activity
GO:0099094	1.000	ligand-gated monoatomic cation channel activity
GO:0022824	1.000	transmitter-gated monoatomic ion channel activity
GO:0005515	0.985	protein binding
GO:0098960	0.977	postsynaptic neurotransmitter receptor activity
GO:1904315	0.965	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0005231	0.952	excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0015318	0.771	inorganic molecular entity transmembrane transporter activity
GO:0022848	0.377	acetylcholine-gated monoatomic cation-selective channel activity
GO:1901702	0.370	salt transmembrane transporter activity
GO:0043176	0.318	amine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.982	response to stimulus
GO:0009987	0.979	cellular process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0023052	0.971	signaling
GO:0042221	0.949	response to chemical
GO:0007165	0.933	signal transduction
GO:0071869	0.915	response to catecholamine
GO:0051179	0.893	localization
GO:0006810	0.882	transport
GO:1903350	0.878	response to dopamine
GO:0071870	0.878	cellular response to catecholamine stimulus
GO:1903351	0.863	cellular response to dopamine
GO:0098662	0.743	inorganic cation transmembrane transport
GO:0007210	0.586	serotonin receptor signaling pathway
GO:0007267	0.313	cell-cell signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.996	protein-containing complex
GO:0043235	0.991	receptor complex
GO:0098797	0.991	plasma membrane protein complex
GO:0034702	0.989	ion channel complex
GO:0098802	0.973	plasma membrane signaling receptor complex
GO:0098878	0.810	neurotransmitter receptor complex
GO:0043226	0.786	organelle
GO:0043227	0.753	membrane-bounded organelle
GO:0005622	0.750	intracellular anatomical structure
GO:0005737	0.716	cytoplasm
GO:0034703	0.708	cation channel complex
GO:0043229	0.700	intracellular organelle
GO:0043231	0.677	intracellular membrane-bounded organelle
GO:0030054	0.672	cell junction
GO:0045202	0.610	synapse
GO:0031090	0.542	organelle membrane
GO:0042995	0.459	cell projection
GO:0043005	0.451	neuron projection
GO:0012505	0.441	endomembrane system
GO:0098590	0.425	plasma membrane region
GO:0031982	0.320	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]