StarFunc result for job id P46100

User Input

>input (2492 residues)
MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENS
KEEGTSSSEKSKSSGSSRSKRKPSIVTKYVESDDEKPLDDETVNEDASNENSENDITMQS
LPKGTVIVQPEPVLNEDKDDFKGPEFRSRSKMKTENLKKRGEDGLHGIVSCTACGQQVNH
FQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDGMDEQCRWCAEGGNLICCDFCHNAFC
KKCILRNLGRKELSTIMDENNQWYCYICHPEPLLDLVTACNSVFENLEQLLQQNKKKIKV
DSEKSNKVYEHTSRFSPKKTSSNCNGEEKKLDDSCSGSVTYSYSALIVPKEMIKKAKKLI
ETTANMNSSYVKFLKQATDNSEISSATKLRQLKAFKSVLADIKKAHLALEEDLNSEFRAM
DAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPT
EEQRTNKSTGGEHKKSDRKEEPQYEPANTSEDLDMDIVSVPSSVPEDIFENLETAMEVQS
SVDHQGDGSSGTEQEVESSSVKLNISSKDNRGGIKSKTTAKVTKELYVKLTPVSLSNSPI
KGADCQEVPQDKDGYKSCGLNPKLEKCGLGQENSDNEHLVENEVSLLLEESDLRRSPRVK
TTPLRRPTETNPVTSNSDEECNETVKEKQKLSVPVRKKDKRNSSDSAIDNPKPNKLPKSK
QSETVDQNSDSDEMLAILKEVSRMSHSSSSDTDINEIHTNHKTLYDLKTQAGKDDKGKRK
RKSSTSGSDFDTKKGKSAKSSIISKKKRQTQSESSNYDSELEKEIKSMSKIGAARTTKKR
IPNTKDFDSSEDEKHSKKGMDNQGHKNLKTSQEGSSDDAERKQERETFSSAEGTVDKDTT
IMELRDRLPKKQQASASTDGVDKLSGKEQSFTSLEVRKVAETKEKSKHLKTKTCKKVQDG
LSDIAEKFLKKDQSDETSEDDKKQSKKGTEEKKKPSDFKKKVIKMEQQYESSSDGTEKLP
EREEICHFPKGIKQIKNGTTDGEKKSKKIRDKTSKKKDELSDYAEKSTGKGDSCDSSEDK
KSKNGAYGREKKRCKLLGKSSRKRQDCSSSDTEKYSMKEDGCNSSDKRLKRIELRERRNL
SSKRNTKEIQSGSSSSDAEESSEDNKKKKQRTSSKKKAVIVKEKKRNSLRTSTKRKQADI
TSSSSSDIEDDDQNSIGEGSSDEQKIKPVTENLVLSSHTGFCQSSGDEALSKSVPVTVDD
DDDDNDPENRIAKKMLLEEIKANLSSDEDGSSDDEPEEGKKRTGKQNEENPGDEEAKNQV
NSESDSDSEESKKPRYRHRLLRHKLTVSDGESGEEKKTKPKEHKEVKGRNRRKVSSEDSE
DSDFQESGVSEEVSESEDEQRPRTRSAKKAELEENQRSYKQKKKRRRIKVQEDSSSENKS
NSEEEEEEKEEEEEEEEEEEEEEEDENDDSKSPGKGRKKIRKILKDDKLRTETQNALKEE
EERRKRIAEREREREKLREVIEIEDASPTKCPITTKLVLDEDEETKEPLVQVHRNMVIKL
KPHQVDGVQFMWDCCCESVKKTKKSPGSGCILAHCMGLGKTLQVVSFLHTVLLCDKLDFS
TALVVCPLNTALNWMNEFEKWQEGLKDDEKLEVSELATVKRPQERSYMLQRWQEDGGVMI
IGYEMYRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVSKAMNSIRS
RRRIILTGTPLQNNLIEYHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADSTMVDVRVM
KKRAHILYEMLAGCVQRKDYTALTKFLPPKHEYVLAVRMTSIQCKLYQYYLDHLTGVGNN
SEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGYFDEDSMDEFIASDSDETSM
SLSSDDYTKKKKKGKKGKKDSSSSGSGSDNDVEVIKVWNSRSRGGGEGNVDETGNNPSVS
LKLEESKATSSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEILRMAEEIGDKVLVF
SQSLISLDLIEDFLELASREKTEDKDKPLIYKGEGKWLRNIDYYRLDGSTTAQSRKKWAE
EFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPV
YVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFTMNELTELYTFEPDLLDDPNS
EKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEERKAAWAEYEA
EKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATN
SVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQM
LISCVQRILMNRRLQQQYNQQQQQQMTYQQATLGHLMMPKPPNLIMNPSNYQQIDMRGMY
QPVAGGMQPPPLQRAPPPMRSKNPGPSQGKSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46100	1.000	1.000	0.000	2492	1.000	1.000	P46100.pdb.gz	ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=6
2	AFDB:Q61687	0.346	0.348	0.000	2476	0.835	0.840	Q61687.pdb.gz	ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus OX=10090 GN=Atrx PE=1 SV=3
3	AFDB:A0A096LNW1	0.068	0.165	5.007E-89	954	0.382	0.999	A0A096LNW1.pdb.gz	A0A096LNW1_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=1
4	PDB:7oo3b	0.186	0.814	1.800E-34	534	0.069	0.324	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
5	PDB:6jylK	0.164	0.747	1.216E-23	504	0.060	0.298	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
6	PDB:6g0lM	0.152	0.416	3.502E-23	855	0.063	0.185	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
7	PDB:7epuB	0.131	0.341	1.116E-22	748	0.059	0.195	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
8	PDB:5vvrM	0.165	0.724	7.195E-22	503	0.062	0.306	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
9	PDB:6gejM	0.152	0.508	2.179E-21	688	0.061	0.221	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
10	PDB:6tdaS	0.162	0.491	6.602E-21	783	0.060	0.192	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
11	PDB:6g0lW	0.160	0.427	1.478E-20	878	0.056	0.159	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:6uxwA	0.170	0.509	2.360E-19	778	0.071	0.228	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
13	PDB:6kw3Y	0.166	0.680	1.601E-18	548	0.062	0.283	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
14	AFDB:Q8T145	0.157	0.211	9.264E-6	1789	0.069	0.096	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
15	AFDB:M9PGK7	0.037	0.039	1.272E-4	2272	0.126	0.138	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
16	AFDB:P49750	0.042	0.047	2.448E-4	2146	0.098	0.114	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
17	AFDB:Q9BVV6	0.026	0.036	1.055E-3	1533	0.084	0.136	Q9BVV6.pdb.gz	TALD3_HUMAN Protein TALPID3 OS=Homo sapiens OX=9606 GN=KIAA0586 PE=1 SV=4
18	AFDB:Q6XZL8	0.029	0.043	2.363E-3	1540	0.078	0.126	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
19	AFDB:Q8INR6	0.032	0.031	3.039E-3	1848	0.076	0.103	Q8INR6.pdb.gz	DOT1L_DROME Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Drosophila melanogaster OX=7227 GN=gpp PE=1 SV=2
20	AFDB:Q54S20	0.040	0.038	3.361E-3	2678	0.106	0.099	Q54S20.pdb.gz	MED13_DICDI Mediator of RNA polymerase II transcription subunit 13 OS=Dictyostelium discoideum OX=44689 GN=amiB PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096LNL9	0.0	2678	1351	0.542	0.999	A0A096LNL9_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=1
2	A0A096LNN3	0.0	1096	528	0.212	1.000	A0A096LNN3_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=1
3	A0A096LNW1	0.0	1927	954	0.382	0.999	A0A096LNW1_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=1
4	A4LAA3	0.0	5123	2492	1.000	1.000	A4LAA3_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=ATRX PE=4 SV=1
5	F1MQ85	0.0	4073	2478	0.898	0.904	F1MQ85_BOVIN DNA helicase OS=Bos taurus OX=9913 GN=ATRX PE=4 SV=3
6	P46100	0.0	5123	2492	1.000	1.000	ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=6
7	Q61687	0.0	3721	2476	0.832	0.838	ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus OX=10090 GN=Atrx PE=1 SV=3
8	Q9GQN5	0.0	724	1311	0.160	0.304	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
9	Q9U7E0	0.0	623	1359	0.154	0.282	ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans OX=6239 GN=xnp-1 PE=1 SV=1
10	P70486	1.78e-155	494	527	0.151	0.713	ATRX_RAT Transcriptional regulator ATRX (Fragment) OS=Rattus norvegicus OX=10116 GN=Atrx PE=1 SV=1
11	Q9Y4B4	3.06e-148	504	1467	0.125	0.213	ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4
12	Q99NG0	4.73e-145	495	1466	0.124	0.211	ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus OX=10090 GN=Rad54l2 PE=1 SV=1
13	F4HW51	7.23e-87	317	1479	0.063	0.107	CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana OX=3702 GN=ATRX PE=2 SV=2
14	Q18241	9.07e-72	268	1274	0.058	0.113	Q18241_CAEEL Helicase ARIP4 OS=Caenorhabditis elegans OX=6239 GN=rad-26 PE=1 SV=2
15	G5EEN6	1.28e-41	169	818	0.043	0.131	G5EEN6_CAEEL DNA repair and recombination protein RAD54-like OS=Caenorhabditis elegans OX=6239 GN=rad-54.l PE=1 SV=1
16	O76460	5.48e-41	167	784	0.044	0.140	RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster OX=7227 GN=okr PE=1 SV=1
17	P70270	6.48e-41	166	747	0.041	0.138	RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus OX=10090 GN=Rad54l PE=1 SV=2
18	Q92698	7.47e-41	166	747	0.041	0.137	RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens OX=9606 GN=RAD54L PE=1 SV=2
19	F1Q8K0	2.49e-39	161	738	0.040	0.134	RAD54_DANRE DNA repair and recombination protein RAD54-like OS=Danio rerio OX=7955 GN=rad54l PE=1 SV=1
20	P41410	3.63e-38	158	852	0.044	0.129	RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp54 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17981 ADD_ATRX	1.9e-27	106.2	Cysteine Rich ADD domain
2	PF00271 Helicase_C	7.5e-12	57.0	Helicase conserved C-terminal domain
3	PF00176 SNF2-rel_dom	6.9e-68	240.5	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254810	0.999	H3 histone, family 3B (H3.3B)
2	9606.ENSP00000363668	0.999	Death domain-associated protein 6
3	9606.ENSP00000372088	0.998	DNA repair protein RAD51 homolog 1
4	9606.ENSP00000476960	0.998	Histone cluster 2 H3 pseudogene 2
5	9606.ENSP00000395535	0.993	Methyl-CpG-binding protein 2
6	9606.ENSP00000355778	0.989	Histone H3.3
7	9606.ENSP00000307853	0.984	Crossover junction endonuclease MUS81
8	9606.ENSP00000209875	0.981	Chromobox protein homolog 5
9	9606.ENSP00000333277	0.978	Histone cluster 2 H3 family member d
10	9606.ENSP00000351284	0.964	DNA repair protein RAD52 homolog
11	9606.ENSP00000269305	0.960	Cellular tumor antigen p53
12	9606.ENSP00000355657	0.954	Histone H3.1t
13	9606.ENSP00000366999	0.951	Histone cluster 1 H3 family member d
14	9606.ENSP00000480826	0.951	Histone cluster 1 H3 family member a
15	9606.ENSP00000482271	0.951	Histone cluster 1 H3 family member e
16	9606.ENSP00000307208	0.950	Nucleosome-remodeling factor subunit BPTF
17	9606.ENSP00000484658	0.950	Histone cluster 1 H3 family member c
18	9606.ENSP00000352252	0.938	Histone cluster 1 H3 family member j
19	9606.ENSP00000358160	0.932	Histone cluster 1 H3 family member h
20	9606.ENSP00000483283	0.932	Histone cluster 1 H3 family member i

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140657	0.996	ATP-dependent activity
GO:0003682	0.996	chromatin binding
GO:0140097	0.995	catalytic activity, acting on DNA
GO:0008094	0.993	ATP-dependent activity, acting on DNA
GO:0042393	0.948	histone binding
GO:0035064	0.885	methylated histone binding
GO:0019904	0.835	protein domain specific binding
GO:0015616	0.583	DNA translocase activity
GO:0070087	0.560	chromo shadow domain binding
GO:1901363	0.389	heterocyclic compound binding
GO:0097159	0.389	organic cyclic compound binding
GO:0003676	0.362	nucleic acid binding
GO:0003677	0.300	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0008152	0.995	metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0060255	0.993	regulation of macromolecule metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0019219	0.985	regulation of nucleobase-containing compound metabolic process
GO:0006325	0.983	chromatin organization
GO:0051726	0.981	regulation of cell cycle
GO:0033044	0.981	regulation of chromosome organization
GO:0043170	0.970	macromolecule metabolic process
GO:0048522	0.965	positive regulation of cellular process
GO:0010468	0.951	regulation of gene expression
GO:0051173	0.951	positive regulation of nitrogen compound metabolic process
GO:0010604	0.951	positive regulation of macromolecule metabolic process
GO:0031325	0.950	positive regulation of cellular metabolic process
GO:0006259	0.946	DNA metabolic process
GO:0045935	0.939	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.931	regulation of transcription by RNA polymerase II
GO:0010564	0.930	regulation of cell cycle process
GO:0048519	0.921	negative regulation of biological process
GO:0006338	0.916	chromatin remodeling
GO:0048523	0.914	negative regulation of cellular process
GO:0010557	0.913	positive regulation of macromolecule biosynthetic process
GO:0031328	0.913	positive regulation of cellular biosynthetic process
GO:0045893	0.886	positive regulation of DNA-templated transcription
GO:0043933	0.864	protein-containing complex organization
GO:0071824	0.852	protein-DNA complex subunit organization
GO:0043412	0.843	macromolecule modification
GO:0050896	0.725	response to stimulus
GO:0045786	0.721	negative regulation of cell cycle
GO:0044085	0.715	cellular component biogenesis
GO:0022607	0.712	cellular component assembly
GO:0065003	0.581	protein-containing complex assembly
GO:0051716	0.551	cellular response to stimulus
GO:0045944	0.459	positive regulation of transcription by RNA polymerase II
GO:0006950	0.427	response to stress
GO:0006974	0.420	cellular response to DNA damage stimulus
GO:0034728	0.387	nucleosome organization
GO:0009892	0.367	negative regulation of metabolic process
GO:0010948	0.351	negative regulation of cell cycle process
GO:0010605	0.327	negative regulation of macromolecule metabolic process
GO:0065004	0.317	protein-DNA complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	1.000	nuclear body
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005694	0.839	chromosome
GO:0098687	0.734	chromosomal region
GO:0000781	0.703	chromosome, telomeric region
GO:0000785	0.670	chromatin
GO:0000792	0.575	heterochromatin
GO:0032991	0.463	protein-containing complex
GO:0099115	0.300	chromosome, subtelomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]