StarFunc result for job id P46108

User Input

>input (304 residues)
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46108	1.000	1.000	7.702E-58	304	1.000	1.000	P46108.pdb.gz	CRK_HUMAN Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2
2	AFDB:Q04929	0.802	0.800	1.114E-50	305	0.852	0.849	Q04929.pdb.gz	CRK_CHICK Adapter molecule crk OS=Gallus gallus OX=9031 GN=CRK PE=1 SV=1
3	AFDB:Q6DEM2	0.535	0.525	3.542E-45	311	0.740	0.723	Q6DEM2.pdb.gz	Q6DEM2_DANRE Adapter molecule crk OS=Danio rerio OX=7955 GN=fb34h10 PE=1 SV=1
4	AFDB:Q6PH06	0.370	0.369	6.616E-39	305	0.615	0.613	Q6PH06.pdb.gz	Q6PH06_DANRE Crk-like protein OS=Danio rerio OX=7955 GN=wu:fj60e01 PE=1 SV=1
5	PDB:2eyzA	0.312	0.312	1.597E-38	304	0.997	0.997	2eyzA.pdb.gz
6	AFDB:P46109	0.446	0.448	7.547E-38	303	0.592	0.594	P46109.pdb.gz	CRKL_HUMAN Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1
7	AFDB:Q9XYM0	0.313	0.351	3.058E-31	271	0.441	0.494	Q9XYM0.pdb.gz	CRK_DROME Adapter molecule Crk OS=Drosophila melanogaster OX=7227 GN=Crk PE=1 SV=1
8	PDB:2lqnA	0.335	0.336	2.786E-30	303	0.595	0.597	2lqnA.pdb.gz
9	AFDB:Q9NHC3	0.336	0.364	1.579E-23	279	0.309	0.337	Q9NHC3.pdb.gz	CED2_CAEEL Cell death abnormality protein 2 OS=Caenorhabditis elegans OX=6239 GN=ced-2 PE=1 SV=1
10	PDB:3qwyA	0.333	0.579	2.457E-15	170	0.204	0.365	3qwyA.pdb.gz
11	AFDB:P87379	0.288	0.376	1.324E-13	229	0.155	0.205	P87379.pdb.gz	GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis OX=8355 GN=grb2-a PE=1 SV=2
12	AFDB:Q13588	0.392	0.523	1.652E-13	217	0.161	0.226	Q13588.pdb.gz	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
13	AFDB:Q9U2T9	0.199	0.080	1.652E-13	1085	0.194	0.054	Q9U2T9.pdb.gz	Q9U2T9_CAEEL Intersectin-1 OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=2
14	PDB:1griA	0.246	0.346	2.529E-11	211	0.155	0.223	1griA.pdb.gz
15	PDB:1k9aB	0.277	0.193	4.141E-6	441	0.141	0.098	1k9aB.pdb.gz
16	PDB:4fl2A	0.257	0.147	5.460E-6	555	0.102	0.056	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:2h8hA	0.300	0.213	8.500E-6	445	0.132	0.090	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:4k2rA	0.273	0.154	4.469E-5	551	0.118	0.065	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
19	PDB:5xzrA	0.260	0.157	4.724E-5	519	0.122	0.071	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
20	PDB:4gwfA	0.275	0.172	7.772E-5	497	0.128	0.078	4gwfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P46108	0.0	619	304	1.000	1.000	CRK_HUMAN Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2
2	Q04929	0.0	525	305	0.842	0.839	CRK_CHICK Adapter molecule crk OS=Gallus gallus OX=9031 GN=CRK PE=1 SV=1
3	Q63768	0.0	617	304	0.997	0.997	CRK_RAT Adapter molecule crk OS=Rattus norvegicus OX=10116 GN=Crk PE=1 SV=1
4	Q64010	0.0	619	304	0.997	0.997	CRK_MOUSE Adapter molecule crk OS=Mus musculus OX=10090 GN=Crk PE=1 SV=1
5	Q6DEM2	4.24e-154	435	311	0.747	0.730	Q6DEM2_DANRE Adapter molecule crk OS=Danio rerio OX=7955 GN=fb34h10 PE=1 SV=1
6	Q6PH06	1.89e-120	349	305	0.622	0.620	Q6PH06_DANRE Crk-like protein OS=Danio rerio OX=7955 GN=wu:fj60e01 PE=1 SV=1
7	Q5U2U2	5.28e-119	345	303	0.602	0.604	CRKL_RAT Crk-like protein OS=Rattus norvegicus OX=10116 GN=Crkl PE=1 SV=1
8	P46109	7.17e-119	345	303	0.605	0.607	CRKL_HUMAN Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1
9	P47941	1.63e-118	344	303	0.599	0.601	CRKL_MOUSE Crk-like protein OS=Mus musculus OX=10090 GN=Crkl PE=1 SV=2
10	Q9XYM0	1.82e-80	246	271	0.438	0.491	CRK_DROME Adapter molecule Crk OS=Drosophila melanogaster OX=7227 GN=Crk PE=1 SV=1
11	Q9NHC3	4.89e-30	116	279	0.299	0.326	CED2_CAEEL Cell death abnormality protein 2 OS=Caenorhabditis elegans OX=6239 GN=ced-2 PE=1 SV=1
12	Q13588	4.97e-20	88.6	217	0.188	0.263	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
13	Q08012	6.75e-19	85.1	211	0.188	0.270	GRAP_DROME Growth factor receptor-bound protein 2 OS=Drosophila melanogaster OX=7227 GN=drk PE=1 SV=1
14	B0LPF3	1.42e-17	81.6	217	0.178	0.249	B0LPF3_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=2 SV=1
15	G1SR27	1.42e-17	81.6	217	0.178	0.249	G1SR27_RABIT Growth factor receptor bound protein 2 OS=Oryctolagus cuniculus OX=9986 GN=GRB2 PE=1 SV=1
16	P62993	1.42e-17	81.6	217	0.178	0.249	GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=1 SV=1
17	P62994	1.42e-17	81.6	217	0.178	0.249	GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus OX=10116 GN=Grb2 PE=1 SV=1
18	Q60631	1.44e-17	81.6	217	0.178	0.249	GRB2_MOUSE Growth factor receptor-bound protein 2 OS=Mus musculus OX=10090 GN=Grb2 PE=1 SV=1
19	Q07883	1.08e-16	79.3	217	0.178	0.249	GRB2_CHICK Growth factor receptor-bound protein 2 OS=Gallus gallus OX=9031 GN=GRB2 PE=1 SV=1
20	Q6GPJ9	9.47e-16	77.0	229	0.161	0.214	GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis OX=8355 GN=grb2-b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12707 DUF3804	6.2e+02	11.5	Protein of unknown function (DUF3804)
2	PF00017 SH2	1.6e-15	68.3	SH2 domain
3	PF00018 SH3_1	4.6e-14	63.1	SH3 domain
4	PF17902 SH3_10	1.4e+02	13.9	SH3 domain
5	PF07653 SH3_2	7.7e-20	81.8	Variant SH3 domain
6	PF14604 SH3_9	1.4e-09	49.1	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007454291.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007456338.1	0.999	E3 ubiquitin-protein ligase CBL
2	118797.XP_007462992.1	0.999	BCAR1, Cas family scaffolding protein
3	118797.XP_007448241.1	0.997	Belongs to the paxillin family.
4	118797.XP_007451249.1	0.997	Belongs to the DOCK family
5	118797.XP_007453178.1	0.997	Rap guanine nucleotide exchange factor 1
6	118797.XP_007464059.1	0.990	GRB2-associated-binding protein 1 isoform X1
7	118797.XP_007464689.1	0.989	Protein tyrosine kinase 2
8	118797.XP_007446288.1	0.986	Mitogen-activated protein kinase 8 isoform X1
9	118797.XP_007453201.1	0.986	Tyrosine-protein kinase ABL1
10	118797.XP_007463741.1	0.985	Epidermal growth factor receptor isoform X1
11	118797.XP_007447788.1	0.983	SRC proto-oncogene, non-receptor tyrosine kinase
12	118797.XP_007446172.1	0.982	Engulfment and cell motility protein 1 isoform X1
13	118797.XP_007466228.1	0.979	Belongs to the protein kinase superfamily. Tyr protein kinase family
14	118797.XP_007463614.1	0.978	Fibroblast growth factor receptor substrate 2
15	118797.XP_007457148.1	0.976	Phosphoinositide-3-kinase regulatory subunit 1
16	118797.XP_007456138.1	0.974	Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chemotaxis. Depending on the context, promotes or inhibits cell proliferation and cell migration. Plays an important role in the differentiation of bone marrow-derived mesenchymal stem cells. Required for normal skeleton development
17	118797.XP_007464247.1	0.974	Neural precursor cell expressed, developmentally down-regulated 9
18	118797.XP_007446985.1	0.969	Engulfment and cell motility 2
19	118797.XP_007446591.1	0.968	Tyrosine-protein kinase ABL1-like
20	118797.XP_007465772.1	0.965	Mitogen-activated protein kinase 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0060090	0.896	molecular adaptor activity
GO:0045309	0.891	protein phosphorylated amino acid binding
GO:0005102	0.883	signaling receptor binding
GO:0019899	0.858	enzyme binding
GO:0030674	0.844	protein-macromolecule adaptor activity
GO:0035591	0.824	signaling adaptor activity
GO:0001784	0.519	phosphotyrosine residue binding
GO:0019900	0.385	kinase binding
GO:0019901	0.327	protein kinase binding
GO:0046875	0.323	ephrin receptor binding
GO:0019904	0.301	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.998	cellular process
GO:0050896	0.993	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0040012	0.980	regulation of locomotion
GO:0048518	0.971	positive regulation of biological process
GO:2000145	0.970	regulation of cell motility
GO:0007165	0.966	signal transduction
GO:0048522	0.963	positive regulation of cellular process
GO:0030334	0.884	regulation of cell migration
GO:0048583	0.859	regulation of response to stimulus
GO:0002682	0.763	regulation of immune system process
GO:0009966	0.727	regulation of signal transduction
GO:0051128	0.703	regulation of cellular component organization
GO:0071840	0.689	cellular component organization or biogenesis
GO:0019222	0.678	regulation of metabolic process
GO:0032502	0.674	developmental process
GO:0016043	0.673	cellular component organization
GO:0048856	0.663	anatomical structure development
GO:0030155	0.660	regulation of cell adhesion
GO:1902531	0.659	regulation of intracellular signal transduction
GO:0065009	0.635	regulation of molecular function
GO:0042221	0.558	response to chemical
GO:0032501	0.556	multicellular organismal process
GO:0007166	0.545	cell surface receptor signaling pathway
GO:0007169	0.539	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048519	0.489	negative regulation of biological process
GO:0031323	0.488	regulation of cellular metabolic process
GO:0060255	0.480	regulation of macromolecule metabolic process
GO:0050790	0.478	regulation of catalytic activity
GO:0008152	0.473	metabolic process
GO:0080090	0.468	regulation of primary metabolic process
GO:0048523	0.467	negative regulation of cellular process
GO:0051171	0.463	regulation of nitrogen compound metabolic process
GO:0048584	0.459	positive regulation of response to stimulus
GO:0071704	0.422	organic substance metabolic process
GO:0044238	0.416	primary metabolic process
GO:0009893	0.390	positive regulation of metabolic process
GO:0007275	0.363	multicellular organism development
GO:0010604	0.357	positive regulation of macromolecule metabolic process
GO:1902533	0.352	positive regulation of intracellular signal transduction
GO:0031325	0.344	positive regulation of cellular metabolic process
GO:0010468	0.343	regulation of gene expression
GO:0051173	0.336	positive regulation of nitrogen compound metabolic process
GO:0044093	0.334	positive regulation of molecular function
GO:0030335	0.334	positive regulation of cell migration
GO:0051246	0.325	regulation of protein metabolic process
GO:0070887	0.315	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0043226	0.990	organelle
GO:0043227	0.981	membrane-bounded organelle
GO:0043229	0.970	intracellular organelle
GO:0005886	0.956	plasma membrane
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0032991	0.892	protein-containing complex
GO:0005576	0.878	extracellular region
GO:0005615	0.837	extracellular space
GO:1903561	0.830	extracellular vesicle
GO:0070062	0.814	extracellular exosome
GO:0043232	0.779	intracellular non-membrane-bounded organelle
GO:0005634	0.769	nucleus
GO:0030054	0.765	cell junction
GO:0012505	0.478	endomembrane system
GO:0031410	0.465	cytoplasmic vesicle
GO:0043233	0.459	organelle lumen
GO:0070013	0.448	intracellular organelle lumen
GO:0005654	0.308	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]