StarFunc result for job id P46109

User Input

>input (303 residues)
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46109	1.000	1.000	9.044E-58	303	1.000	1.000	P46109.pdb.gz	CRKL_HUMAN Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1
2	AFDB:Q6PH06	0.428	0.426	9.881E-49	305	0.832	0.826	Q6PH06.pdb.gz	Q6PH06_DANRE Crk-like protein OS=Danio rerio OX=7955 GN=wu:fj60e01 PE=1 SV=1
3	PDB:2lqnA	0.350	0.350	7.223E-43	303	1.000	1.000	2lqnA.pdb.gz
4	AFDB:Q6DEM2	0.477	0.466	2.924E-39	311	0.611	0.595	Q6DEM2.pdb.gz	Q6DEM2_DANRE Adapter molecule crk OS=Danio rerio OX=7955 GN=fb34h10 PE=1 SV=1
5	AFDB:P46108	0.448	0.446	9.557E-38	304	0.594	0.592	P46108.pdb.gz	CRK_HUMAN Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2
6	AFDB:Q04929	0.375	0.373	5.618E-37	305	0.581	0.577	Q04929.pdb.gz	CRK_CHICK Adapter molecule crk OS=Gallus gallus OX=9031 GN=CRK PE=1 SV=1
7	AFDB:Q9XYM0	0.318	0.355	4.865E-31	271	0.439	0.491	Q9XYM0.pdb.gz	CRK_DROME Adapter molecule Crk OS=Drosophila melanogaster OX=7227 GN=Crk PE=1 SV=1
8	PDB:2eyzA	0.302	0.302	1.871E-24	304	0.607	0.605	2eyzA.pdb.gz
9	AFDB:Q9NHC3	0.298	0.322	1.857E-22	279	0.297	0.323	Q9NHC3.pdb.gz	CED2_CAEEL Cell death abnormality protein 2 OS=Caenorhabditis elegans OX=6239 GN=ced-2 PE=1 SV=1
10	AFDB:P87379	0.300	0.390	3.568E-15	229	0.149	0.197	P87379.pdb.gz	GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis OX=8355 GN=grb2-a PE=1 SV=2
11	AFDB:Q9R0C8	0.292	0.109	4.074E-14	847	0.175	0.063	Q9R0C8.pdb.gz	VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus OX=10090 GN=Vav3 PE=1 SV=2
12	PDB:3qwyA	0.304	0.527	4.292E-14	170	0.201	0.359	3qwyA.pdb.gz
13	AFDB:Q13588	0.315	0.417	4.551E-14	217	0.149	0.207	Q13588.pdb.gz	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
14	PDB:1griA	0.280	0.393	1.007E-12	211	0.139	0.199	1griA.pdb.gz
15	PDB:2h8hA	0.287	0.199	5.296E-7	445	0.142	0.097	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
16	PDB:1k9aB	0.270	0.190	3.290E-6	441	0.119	0.082	1k9aB.pdb.gz
17	PDB:4fl2A	0.256	0.145	7.977E-6	555	0.116	0.063	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
18	PDB:1ka6A	0.279	0.731	1.934E-5	107	0.079	0.224	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
19	PDB:4k2rA	0.291	0.165	2.696E-5	551	0.122	0.067	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
20	PDB:4gwfA	0.261	0.164	3.364E-5	497	0.122	0.074	4gwfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P46109	0.0	631	303	1.000	1.000	CRKL_HUMAN Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1
2	P47941	0.0	616	303	0.967	0.967	CRKL_MOUSE Crk-like protein OS=Mus musculus OX=10090 GN=Crkl PE=1 SV=2
3	Q5U2U2	0.0	615	303	0.967	0.967	CRKL_RAT Crk-like protein OS=Rattus norvegicus OX=10116 GN=Crkl PE=1 SV=1
4	Q6PH06	0.0	517	305	0.832	0.826	Q6PH06_DANRE Crk-like protein OS=Danio rerio OX=7955 GN=wu:fj60e01 PE=1 SV=1
5	Q6DEM2	2.82e-123	357	311	0.634	0.617	Q6DEM2_DANRE Adapter molecule crk OS=Danio rerio OX=7955 GN=fb34h10 PE=1 SV=1
6	Q64010	1.08e-118	345	304	0.601	0.599	CRK_MOUSE Adapter molecule crk OS=Mus musculus OX=10090 GN=Crk PE=1 SV=1
7	P46108	1.18e-118	345	304	0.601	0.599	CRK_HUMAN Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2
8	Q63768	4.78e-118	343	304	0.597	0.595	CRK_RAT Adapter molecule crk OS=Rattus norvegicus OX=10116 GN=Crk PE=1 SV=1
9	Q04929	1.67e-116	339	305	0.597	0.593	CRK_CHICK Adapter molecule crk OS=Gallus gallus OX=9031 GN=CRK PE=1 SV=1
10	Q9XYM0	7.63e-84	255	271	0.442	0.494	CRK_DROME Adapter molecule Crk OS=Drosophila melanogaster OX=7227 GN=Crk PE=1 SV=1
11	Q9NHC3	9.12e-28	110	279	0.300	0.326	CED2_CAEEL Cell death abnormality protein 2 OS=Caenorhabditis elegans OX=6239 GN=ced-2 PE=1 SV=1
12	Q13588	2.25e-20	89.4	217	0.162	0.226	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
13	Q08012	2.50e-15	75.5	211	0.135	0.194	GRAP_DROME Growth factor receptor-bound protein 2 OS=Drosophila melanogaster OX=7227 GN=drk PE=1 SV=1
14	P29355	5.34e-15	74.7	228	0.145	0.193	SEM5_CAEEL Sex muscle abnormal protein 5 OS=Caenorhabditis elegans OX=6239 GN=sem-5 PE=1 SV=1
15	Q6GPJ9	6.62e-15	74.7	229	0.152	0.201	GRB2B_XENLA Growth factor receptor-bound protein 2-B OS=Xenopus laevis OX=8355 GN=grb2-b PE=1 SV=1
16	P87379	2.03e-14	73.2	229	0.152	0.201	GRB2A_XENLA Growth factor receptor-bound protein 2-A OS=Xenopus laevis OX=8355 GN=grb2-a PE=1 SV=2
17	B0LPF3	7.58e-14	71.2	217	0.152	0.212	B0LPF3_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=2 SV=1
18	G1SR27	7.58e-14	71.2	217	0.152	0.212	G1SR27_RABIT Growth factor receptor bound protein 2 OS=Oryctolagus cuniculus OX=9986 GN=GRB2 PE=1 SV=1
19	P62993	7.58e-14	71.2	217	0.152	0.212	GRB2_HUMAN Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=1 SV=1
20	P62994	7.58e-14	71.2	217	0.152	0.212	GRB2_RAT Growth factor receptor-bound protein 2 OS=Rattus norvegicus OX=10116 GN=Grb2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14603 hSH3	57	15.7	Helically-extended SH3 domain
2	PF00017 SH2	2e-18	77.6	SH2 domain
3	PF00018 SH3_1	3.6e-18	76.2	SH3 domain
4	PF07653 SH3_2	1.9e-20	83.7	Variant SH3 domain
5	PF14604 SH3_9	1.6e-13	61.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000117

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009017	0.999	Cbl proto-oncogene, E3 ubiquitin protein ligase
2	61853.ENSNLEP00000006513	0.993	GRB2-associated binding protein 1
3	61853.ENSNLEP00000015570	0.991	Rap guanine nucleotide exchange factor (GEF) 1
4	61853.ENSNLEP00000007631	0.982	Tyrosine-protein kinase
5	61853.ENSNLEP00000015801	0.978	BCAR1, Cas family scaffolding protein
6	61853.ENSNLEP00000000652	0.977	Dedicator of cytokinesis 1
7	61853.ENSNLEP00000004772	0.975	Phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
8	61853.ENSNLEP00000018842	0.973	BCR, RhoGEF and GTPase activating protein
9	61853.ENSNLEP00000004655	0.965	Fibroblast growth factor receptor substrate 2
10	61853.ENSNLEP00000010419	0.963	Receptor protein-tyrosine kinase
11	61853.ENSNLEP00000016019	0.963	Uncharacterized protein
12	61853.ENSNLEP00000003075	0.952	Engulfment and cell motility 1
13	61853.ENSNLEP00000008388	0.952	Engulfment and cell motility 2
14	61853.ENSNLEP00000018944	0.951	Mitogen-activated protein kinase 8
15	61853.ENSNLEP00000017945	0.948	DAB1, reelin adaptor protein
16	61853.ENSNLEP00000009140	0.943	Cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion).
17	61853.ENSNLEP00000000953	0.939	Tyrosine-protein kinase receptor
18	61853.ENSNLEP00000011344	0.932	Mitogen-activated protein kinase 10
19	61853.ENSNLEP00000000851	0.927	CRK proto-oncogene, adaptor protein
20	61853.ENSNLEP00000000822	0.926	Neural precursor cell expressed, developmentally down-regulated 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.530	enzyme binding
GO:0005102	0.489	signaling receptor binding
GO:0019901	0.452	protein kinase binding
GO:0045309	0.446	protein phosphorylated amino acid binding
GO:0001784	0.358	phosphotyrosine residue binding
GO:0045296	0.322	cadherin binding
GO:0042802	0.304	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.991	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0048583	0.987	regulation of response to stimulus
GO:0032502	0.985	developmental process
GO:0051716	0.982	cellular response to stimulus
GO:0048522	0.981	positive regulation of cellular process
GO:0023052	0.980	signaling
GO:0048856	0.941	anatomical structure development
GO:0040012	0.939	regulation of locomotion
GO:0007165	0.936	signal transduction
GO:2000145	0.902	regulation of cell motility
GO:0009966	0.875	regulation of signal transduction
GO:1902531	0.873	regulation of intracellular signal transduction
GO:0019222	0.802	regulation of metabolic process
GO:0048584	0.766	positive regulation of response to stimulus
GO:0032501	0.740	multicellular organismal process
GO:0007166	0.694	cell surface receptor signaling pathway
GO:0060255	0.691	regulation of macromolecule metabolic process
GO:0030334	0.644	regulation of cell migration
GO:0031323	0.589	regulation of cellular metabolic process
GO:0048869	0.584	cellular developmental process
GO:0065009	0.572	regulation of molecular function
GO:0080090	0.562	regulation of primary metabolic process
GO:0042221	0.535	response to chemical
GO:0051171	0.493	regulation of nitrogen compound metabolic process
GO:0070887	0.488	cellular response to chemical stimulus
GO:0048519	0.486	negative regulation of biological process
GO:1902533	0.479	positive regulation of intracellular signal transduction
GO:0009893	0.477	positive regulation of metabolic process
GO:0048523	0.471	negative regulation of cellular process
GO:0009653	0.469	anatomical structure morphogenesis
GO:0051246	0.467	regulation of protein metabolic process
GO:0008152	0.457	metabolic process
GO:0001934	0.456	positive regulation of protein phosphorylation
GO:0007169	0.439	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0030154	0.437	cell differentiation
GO:0010468	0.409	regulation of gene expression
GO:0035556	0.406	intracellular signal transduction
GO:0071840	0.386	cellular component organization or biogenesis
GO:0043408	0.374	regulation of MAPK cascade
GO:0071495	0.372	cellular response to endogenous stimulus
GO:0071704	0.361	organic substance metabolic process
GO:0042127	0.352	regulation of cell population proliferation
GO:0050790	0.350	regulation of catalytic activity
GO:0044093	0.344	positive regulation of molecular function
GO:0007275	0.342	multicellular organism development
GO:0016043	0.339	cellular component organization
GO:0051128	0.320	regulation of cellular component organization
GO:0030155	0.316	regulation of cell adhesion
GO:0006950	0.314	response to stress
GO:0010033	0.300	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0043227	0.971	membrane-bounded organelle
GO:0043229	0.968	intracellular organelle
GO:0005886	0.966	plasma membrane
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0005634	0.831	nucleus
GO:0070013	0.661	intracellular organelle lumen
GO:0031981	0.512	nuclear lumen
GO:0005654	0.475	nucleoplasm
GO:0030054	0.367	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]