StarFunc result for job id P46199

User Input

>input (727 residues)
MNQKLLKLENLLRFHTIYRQLHSLCQRRALRQWRHGFSSAYPVWTAQLCAWPWPTDVLTG
AALSQYRLLVTKKEEGPWKSQLSSTKSKKVVEVWIGMTIEELARAMEKNTDYVYEALLNT
DIDIDSLEADSHLDEVWIKEVITKAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTPRS
PVVTIMGHVDHGKTTLLDKFRKTQVAAVETGGITQHIGAFLVSLPSGEKITFLDTPGHAA
FSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCDKAEADPEKV
KKELLAYDVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELKADPNGPVEGTVI
ESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKCWAKVRLMFDENGKTIDEAYPSMPVGITG
WRDLPSAGEEILEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREK
YGHLLWKKRSILRFLERKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDA
SHECELELVHFGVGDVSANDVNLAETFDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIY
RLVEDLQEELSSRLPCAVEEHPVGEASILATFSVTEGKKKVPVAGCRVQKGQLEKQKKFK
LTRNGHVIWKGSLTSLKHHKDDISIVKTGMDCGLSLDEDNMEFQVGDRIVCYEEKQIQAK
TSWDPGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7po27	0.732	0.921	0.000	571	0.785	1.000	7po27.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
2	AFDB:P46198	0.880	0.880	0.000	727	0.850	0.850	P46198.pdb.gz	IF2M_BOVIN Translation initiation factor IF-2, mitochondrial OS=Bos taurus OX=9913 GN=MTIF2 PE=1 SV=1
3	AFDB:P46199	1.000	1.000	0.000	727	1.000	1.000	P46199.pdb.gz	IF2M_HUMAN Translation initiation factor IF-2, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF2 PE=1 SV=2
4	AFDB:Q68FQ5	0.835	0.835	0.000	727	0.834	0.834	Q68FQ5.pdb.gz	Q68FQ5_RAT Mitochondrial translational initiation factor 2 OS=Rattus norvegicus OX=10116 GN=Mtif2 PE=1 SV=1
5	AFDB:P0A705	0.620	0.512	3.054E-74	890	0.333	0.272	P0A705.pdb.gz	IF2_ECOLI Translation initiation factor IF-2 OS=Escherichia coli (strain K12) OX=83333 GN=infB PE=1 SV=1
6	AFDB:Q9HV55	0.598	0.522	1.111E-73	840	0.338	0.293	Q9HV55.pdb.gz	IF2_PSEAE Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=infB PE=1 SV=1
7	AFDB:O59683	0.620	0.653	9.909E-72	686	0.315	0.334	O59683.pdb.gz	IF2M_SCHPO Translation initiation factor IF-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.15c PE=3 SV=1
8	AFDB:Q9SHI1	0.629	0.454	7.061E-70	1026	0.333	0.236	Q9SHI1.pdb.gz	IF2C_ARATH Translation initiation factor IF-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g17220 PE=2 SV=2
9	AFDB:P9WKK1	0.638	0.519	1.832E-68	900	0.325	0.262	P9WKK1.pdb.gz	IF2_MYCTU Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=infB PE=1 SV=1
10	AFDB:P25038	0.685	0.733	2.563E-67	676	0.307	0.330	P25038.pdb.gz	IF2M_YEAST Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IFM1 PE=1 SV=2
11	PDB:7unvx	0.628	0.766	2.714E-61	593	0.334	0.410	7unvx.pdb.gz	Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
12	AFDB:Q57WE3	0.607	0.564	3.548E-55	787	0.275	0.254	Q57WE3.pdb.gz	Q57WE3_TRYB2 Translation initiation factor IF-2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.850 PE=1 SV=1
13	PDB:3jcjf	0.644	0.909	5.915E-54	509	0.301	0.430	3jcjf.pdb.gz	Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association.
14	PDB:7pubIA	0.517	0.541	2.534E-48	693	0.261	0.274	7pubIA.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
15	PDB:3jcex	0.304	0.375	2.075E-16	586	0.100	0.125	3jcex.pdb.gz	EF4 disengages the peptidyl-tRNA CCA end and facilitates back-translocation on the 70S ribosome
16	PDB:6ji2A	0.287	0.458	4.070E-16	432	0.098	0.164	6ji2A.pdb.gz	Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.
17	PDB:1ob2A	0.279	0.480	3.635E-15	393	0.110	0.204	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU
18	PDB:5lzwjj	0.271	0.440	5.384E-15	425	0.092	0.158	5lzwjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
19	PDB:7paj9	0.298	0.525	5.695E-15	393	0.106	0.196	7paj9.pdb.gz	Visualizing translation dynamics at atomic detail inside a bacterial cell.
20	PDB:5lzbz	0.299	0.349	9.439E-15	614	0.099	0.117	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y2H0	0.0	1065	663	0.746	0.817	A0A8I5Y2H0_RAT Mitochondrial translational initiation factor 2 OS=Rattus norvegicus OX=10116 GN=Mtif2 PE=1 SV=1
2	H7C213	0.0	590	301	0.413	0.997	H7C213_HUMAN Mitochondrial translational initiation factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=MTIF2 PE=1 SV=2
3	P46198	0.0	1278	727	0.850	0.850	IF2M_BOVIN Translation initiation factor IF-2, mitochondrial OS=Bos taurus OX=9913 GN=MTIF2 PE=1 SV=1
4	P46199	0.0	1492	727	1.000	1.000	IF2M_HUMAN Translation initiation factor IF-2, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF2 PE=1 SV=2
5	Q68FQ5	0.0	1240	727	0.834	0.834	Q68FQ5_RAT Mitochondrial translational initiation factor 2 OS=Rattus norvegicus OX=10116 GN=Mtif2 PE=1 SV=1
6	Q91YJ5	0.0	1226	727	0.813	0.813	IF2M_MOUSE Translation initiation factor IF-2, mitochondrial OS=Mus musculus OX=10090 GN=Mtif2 PE=1 SV=2
7	Q9HV55	6.33e-124	391	840	0.314	0.271	IF2_PSEAE Translation initiation factor IF-2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=infB PE=1 SV=1
8	O59683	1.01e-120	379	686	0.290	0.308	IF2M_SCHPO Translation initiation factor IF-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.15c PE=3 SV=1
9	P9WKK1	1.22e-118	379	900	0.301	0.243	IF2_MYCTU Translation initiation factor IF-2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=infB PE=1 SV=1
10	P25038	2.23e-117	369	676	0.292	0.314	IF2M_YEAST Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IFM1 PE=1 SV=2
11	Q9SHI1	7.65e-117	377	1026	0.323	0.229	IF2C_ARATH Translation initiation factor IF-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g17220 PE=2 SV=2
12	P0A705	1.08e-114	369	890	0.307	0.251	IF2_ECOLI Translation initiation factor IF-2 OS=Escherichia coli (strain K12) OX=83333 GN=infB PE=1 SV=1
13	Q57WE3	3.27e-68	241	787	0.252	0.233	Q57WE3_TRYB2 Translation initiation factor IF-2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.850 PE=1 SV=1
14	Q8I3U2	1.47e-51	196	1610	0.143	0.065	Q8I3U2_PLAF7 Sporozoite surface antigen MB2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0516600 PE=3 SV=1
15	Q8IBA3	2.79e-37	152	1397	0.102	0.053	Q8IBA3_PLAF7 Translation initiation factor IF-2, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0827100 PE=3 SV=1
16	Q8IEJ7	4.76e-25	114	1128	0.084	0.054	Q8IEJ7_PLAF7 Translation initiation factor IF-2, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1312400 PE=3 SV=1
17	Q586X2	1.07e-24	112	833	0.118	0.103	Q586X2_TRYB2 Translation initiation factor IF-2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.240 PE=3 SV=1
18	P39730	1.13e-23	109	1002	0.116	0.084	IF2P_YEAST Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FUN12 PE=1 SV=2
19	Q5A782	1.79e-23	108	1017	0.084	0.060	Q5A782_CANAL Eukaryotic translation initiation factor 5B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FUN12 PE=3 SV=1
20	M9NFL1	2.64e-23	108	1090	0.116	0.077	M9NFL1_DROME Eukaryotic translation initiation factor 5B OS=Drosophila melanogaster OX=7227 GN=eIF5B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	0.55	21.2	ADP-ribosylation factor family
2	PF00350 Dynamin_N	9.7	17.7	Dynamin family
3	PF02421 FeoB_N	0.36	21.8	Ferrous iron transport protein B
4	PF00009 GTP_EFTU	5.2e-29	112.7	Elongation factor Tu GTP binding domain
5	PF14578 GTP_EFTU_D4	3.1e+02	12.6	Elongation factor Tu domain 4
6	PF11987 IF-2	3.5e-27	106.1	Translation-initiation factor 2
7	PF01926 MMR_HSR1	6.8e-06	37.5	50S ribosome-binding GTPase
8	PF08336 P4Ha_N	5.4e+02	11.9	Prolyl 4-Hydroxylase alpha-subunit, N-terminal region
9	PF01011 PQQ	5.1e+02	11.9	PQQ enzyme repeat
10	PF00071 Ras	0.074	24.1	Ras family
11	PF08477 Roc	8.5	18.0	Ras of Complex, Roc, domain of DAPkinase
12	PF03193 RsgA_GTPase	31	15.9	RsgA GTPase
13	PF09439 SRPRB	0.49	21.3	Signal recognition particle receptor beta subunit
14	PF05621 TniB	1.8e+02	12.9	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263629

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370508	0.995	Translation initiation factor IF-3, mitochondrial
2	9606.ENSP00000317376	0.988	Mitochondrial ribosomal protein S11
3	9606.ENSP00000245539	0.985	Mitochondrial ribosomal protein S7
4	9606.ENSP00000053468	0.984	Mitochondrial ribosomal protein S10
5	9606.ENSP00000258455	0.983	Mitochondrial ribosomal protein S9
6	9606.ENSP00000362036	0.983	Mitochondrial ribosomal protein S16
7	9606.ENSP00000272418	0.981	Belongs to the universal ribosomal protein uS5 family.
8	9606.ENSP00000384952	0.980	Mitochondrial ribosomal protein S12
9	9606.ENSP00000362208	0.975	Mitochondrial ribosomal protein S15
10	9606.ENSP00000382250	0.974	Mitochondrial ribosomal protein S6
11	9606.ENSP00000420714	0.974	Mitochondrial ribosomal protein S14
12	9606.ENSP00000081029	0.969	Mitochondrial ribosomal protein S35
13	9606.ENSP00000360850	0.969	Mitochondrial ribosomal protein S2
14	9606.ENSP00000254630	0.957	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
15	9606.ENSP00000357320	0.953	28S ribosomal protein S29, mitochondrial
16	9606.ENSP00000418008	0.951	Mitochondrial ribosomal protein S22
17	9606.ENSP00000426941	0.944	28S ribosomal protein S27, mitochondrial
18	9606.ENSP00000259873	0.935	Mitochondrial ribosomal protein S18B
19	9606.ENSP00000369682	0.934	Mitochondrial ribosomal protein S26
20	9606.ENSP00000253686	0.931	Mitochondrial ribosomal protein S25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0008135	0.994	translation factor activity, RNA binding
GO:0003723	0.969	RNA binding
GO:0005515	0.858	protein binding
GO:0043168	0.414	anion binding
GO:0003824	0.395	catalytic activity
GO:0005525	0.306	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0006412	0.991	translation
GO:0006413	0.932	translational initiation
GO:0065007	0.840	biological regulation
GO:0050794	0.829	regulation of cellular process
GO:0019222	0.796	regulation of metabolic process
GO:0060255	0.768	regulation of macromolecule metabolic process
GO:0051171	0.754	regulation of nitrogen compound metabolic process
GO:0031323	0.749	regulation of cellular metabolic process
GO:0080090	0.680	regulation of primary metabolic process
GO:2000112	0.628	regulation of cellular macromolecule biosynthetic process
GO:0034248	0.618	regulation of amide metabolic process
GO:0010468	0.614	regulation of gene expression
GO:0010608	0.586	post-transcriptional regulation of gene expression
GO:0006417	0.478	regulation of translation
GO:0006446	0.368	regulation of translational initiation
GO:0071840	0.366	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005634	0.800	nucleus
GO:0031981	0.692	nuclear lumen
GO:0005654	0.559	nucleoplasm
GO:0005759	0.470	mitochondrial matrix
GO:0043232	0.464	intracellular non-membrane-bounded organelle
GO:0032991	0.398	protein-containing complex
GO:0016020	0.332	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]