StarFunc result for job id P46379

User Input

>input (1132 residues)
MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLL
SRMETLPYLQCRGGPQPQHSQPPPQPPAVTPEPVALSSQTSEPVESEAPPREPMEAEEVE
ERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEV
LGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRP
MSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNV
ESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLG
PPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQM
VSGLVGQLLMQPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQP
SMADLQFSQLLGNLLGPAGPGAGGSGVASPTITVAMPGVPAFLQGMTDFLQATQTAPPPP
PPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGARA
GSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQR
LQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLE
FLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIR
RMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGA
ERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVP
IIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLT
SPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G1SU30	0.257	0.252	0.000	1162	0.941	0.917	G1SU30.pdb.gz	G1SU30_RABIT Large proline-rich protein BAG6 OS=Oryctolagus cuniculus OX=9986 GN=BAG6 PE=4 SV=2
2	AFDB:P46379	1.000	1.000	0.000	1132	1.000	1.000	P46379.pdb.gz	BAG6_HUMAN Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2
3	AFDB:Q9Z1R2	0.267	0.262	0.000	1154	0.939	0.921	Q9Z1R2.pdb.gz	BAG6_MOUSE Large proline-rich protein BAG6 OS=Mus musculus OX=10090 GN=Bag6 PE=1 SV=1
4	PDB:3dbhI	0.068	0.786	1.419E-5	86	0.023	0.302	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
5	PDB:6mdhA	0.063	0.460	4.940E-5	149	0.018	0.134	6mdhA.pdb.gz
6	PDB:3ai5A	0.063	0.234	5.705E-5	299	0.022	0.084	3ai5A.pdb.gz
7	PDB:6yvaC	0.065	0.444	6.912E-5	155	0.020	0.148	6yvaC.pdb.gz
8	PDB:6ef3u	0.061	0.806	9.218E-5	75	0.022	0.333	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
9	PDB:7rbsB	0.065	0.442	1.563E-4	157	0.013	0.096	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
10	PDB:1oqyA	0.061	0.182	2.779E-4	363	0.038	0.118	1oqyA.pdb.gz
11	PDB:3plvA	0.066	0.842	3.059E-4	80	0.014	0.200	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
12	PDB:5xqmA	0.065	0.683	3.210E-4	90	0.014	0.178	5xqmA.pdb.gz
13	PDB:4pyuA	0.063	0.870	7.987E-4	76	0.011	0.171	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
14	AFDB:Q4GYV1	0.074	0.105	1.901E-3	713	0.085	0.135	Q4GYV1.pdb.gz	Q4GYV1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.2710 PE=4 SV=1
15	AFDB:X1WE18	0.054	0.056	2.659E-3	1085	0.140	0.147	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
16	AFDB:Q8SXD4	0.084	0.085	3.904E-3	1122	0.079	0.079	Q8SXD4.pdb.gz	MIDN_DROME Midnolin homolog OS=Drosophila melanogaster OX=7227 GN=stx PE=1 SV=1
17	AFDB:D3ZUI5	0.062	0.062	4.730E-3	1133	0.100	0.100	D3ZUI5.pdb.gz	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
18	AFDB:A0A2K1J5A5	0.059	0.091	4.962E-3	709	0.084	0.134	A0A2K1J5A5.pdb.gz	SOK3_PHYPA Protein SOSEKI 3 OS=Physcomitrium patens OX=3218 GN=SOK3 PE=1 SV=1
19	AFDB:P53804	0.046	0.033	9.259E-3	2025	0.119	0.067	P53804.pdb.gz	TTC3_HUMAN E3 ubiquitin-protein ligase TTC3 OS=Homo sapiens OX=9606 GN=TTC3 PE=1 SV=2
20	AFDB:Q6ZRI6	0.051	0.054	1.177E-2	1047	0.146	0.158	Q6ZRI6.pdb.gz	CO039_HUMAN Uncharacterized protein C15orf39 OS=Homo sapiens OX=9606 GN=C15orf39 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1U9X7A6	0.0	2229	1126	0.995	1.000	A0A1U9X7A6_HUMAN Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 PE=4 SV=1
2	A5D9M6	0.0	1864	1128	0.938	0.941	BAG6_PIG Large proline-rich protein BAG6 OS=Sus scrofa OX=9823 GN=BAG6 PE=1 SV=1
3	G1SU30	0.0	1843	1162	0.930	0.906	G1SU30_RABIT Large proline-rich protein BAG6 OS=Oryctolagus cuniculus OX=9986 GN=BAG6 PE=4 SV=2
4	P46379	0.0	2249	1132	1.000	1.000	BAG6_HUMAN Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2
5	Q6MG49	0.0	975	1146	0.450	0.444	BAG6_RAT Large proline-rich protein BAG6 OS=Rattus norvegicus OX=10116 GN=Bag6 PE=1 SV=2
6	Q9Z1R2	0.0	985	1154	0.455	0.446	BAG6_MOUSE Large proline-rich protein BAG6 OS=Mus musculus OX=10090 GN=Bag6 PE=1 SV=1
7	B7Z0D3	3.89e-16	86.7	1346	0.030	0.025	B7Z0D3_DROME Large proline-rich protein BAG6 OS=Drosophila melanogaster OX=7227 GN=clone 2.45 PE=1 SV=1
8	D5LXJ0	6.15e-12	72.4	691	0.046	0.075	CIP73_LOTJA Ubiquitin-like domain-containing protein CIP73 OS=Lotus japonicus OX=34305 GN=CIP73 PE=1 SV=1
9	Q9SII8	1.17e-07	58.2	551	0.030	0.062	DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana OX=3702 GN=DSK2B PE=1 SV=1
10	Q10169	4.01e-07	55.8	354	0.024	0.076	DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph1 PE=4 SV=1
11	P49632	3.48e-06	49.7	128	0.023	0.203	RL40_CAEEL Ubiquitin-ribosomal protein eL40 fusion protein OS=Caenorhabditis elegans OX=6239 GN=ubq-2 PE=3 SV=2
12	Q9NIF3	3.86e-06	53.1	523	0.024	0.052	UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum OX=44689 GN=ubqln PE=1 SV=1
13	Q9SII9	4.91e-06	53.1	538	0.025	0.052	DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana OX=3702 GN=DSK2A PE=1 SV=2
14	J3QS39	1.10e-05	47.4	93	0.022	0.269	J3QS39_HUMAN Ubiquitin B (Fragment) OS=Homo sapiens OX=9606 GN=UBB PE=1 SV=1
15	B9DHA6	1.20e-05	48.1	128	0.022	0.195	RL40A_ARATH Ubiquitin-ribosomal protein eL40z fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPL40A PE=2 SV=1
16	Q42202	1.20e-05	48.1	128	0.022	0.195	RL40B_ARATH Ubiquitin-ribosomal protein eL40y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPL40B PE=2 SV=2
17	P59271	1.42e-05	48.5	156	0.022	0.160	R27AA_ARATH Ubiquitin-ribosomal protein eS31z fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AA PE=2 SV=2
18	P62980	1.42e-05	48.5	156	0.022	0.160	RS27A_SOLLC Ubiquitin-ribosomal protein eS31 fusion protein OS=Solanum lycopersicum OX=4081 GN=UBI3 PE=1 SV=2
19	Q9SHE7	1.42e-05	48.5	156	0.023	0.167	RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana OX=3702 GN=RUB1 PE=1 SV=3
20	P59232	1.45e-05	48.5	157	0.022	0.159	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12057 BAG6	1.4e-41	152.3	BCL2-associated athanogene 6
2	PF10302 Dsc3_N	52	15.8	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
3	PF11159 DUF2939	6.4e+02	12.2	Protein of unknown function (DUF2939)
4	PF11976 Rad60-SLD	0.099	23.8	Ubiquitin-2 like Rad60 SUMO-like
5	PF13881 Rad60-SLD_2	1.5e+02	13.9	Ubiquitin-2 like Rad60 SUMO-like
6	PF18396 TBK1_ULD	2.8e+02	12.8	TANK binding kinase 1 ubiquitin-like domain
7	PF00240 ubiquitin	1.1e-12	58.9	Ubiquitin family
8	PF18037 Ubiquitin_5	3.6e+02	12.9	Ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365131

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265857	0.999	Golgi to ER traffic protein 4 homolog
2	9606.ENSP00000358674	0.999	Ubiquitin-like protein 4A
3	9606.ENSP00000342156	0.995	Natural cytotoxicity triggering receptor 3
4	9606.ENSP00000292363	0.991	E3 ubiquitin-protein ligase RNF126
5	9606.ENSP00000221566	0.982	Small glutamine-rich tetratricopeptide repeat-containing protein alpha
6	9606.ENSP00000312002	0.970	Hepatitis A virus cellular receptor 2
7	9606.ENSP00000466379	0.945	ATPase ASNA1
8	9606.ENSP00000290649	0.874	E3 ubiquitin-protein ligase AMFR
9	9606.ENSP00000384018	0.843	Nuclear receptor corepressor 2
10	9606.ENSP00000364791	0.840	Protein G8
11	9606.ENSP00000364935	0.771	Chloride intracellular channel protein 1
12	9606.ENSP00000370395	0.763	Small glutamine-rich tetratricopeptide repeat-containing protein beta
13	9606.ENSP00000365201	0.759	Protein PRRC2A
14	9606.ENSP00000327716	0.757	Tail-anchored protein insertion receptor WRB
15	9606.ENSP00000223641	0.748	Protein transport protein Sec61 subunit beta
16	9606.ENSP00000351777	0.737	Transitional endoplasmic reticulum ATPase
17	9606.ENSP00000389649	0.729	ATP synthase-coupling factor 6, mitochondrial
18	9606.ENSP00000261942	0.718	FAS-associated factor 2
19	9606.ENSP00000284981	0.703	Amyloid-beta A4 protein
20	9606.ENSP00000294179	0.703	Syntaxin-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0044877	0.829	protein-containing complex binding
GO:0019899	0.814	enzyme binding
GO:0031625	0.634	ubiquitin protein ligase binding
GO:0051787	0.627	misfolded protein binding
GO:1990381	0.608	ubiquitin-specific protease binding
GO:0042802	0.597	identical protein binding
GO:0043022	0.552	ribosome binding
GO:0005102	0.490	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0050896	0.984	response to stimulus
GO:0044238	0.982	primary metabolic process
GO:0032501	0.974	multicellular organismal process
GO:0010498	0.967	proteasomal protein catabolic process
GO:0044237	0.959	cellular metabolic process
GO:0051716	0.952	cellular response to stimulus
GO:0043632	0.945	modification-dependent macromolecule catabolic process
GO:0031647	0.936	regulation of protein stability
GO:0034976	0.932	response to endoplasmic reticulum stress
GO:0097193	0.931	intrinsic apoptotic signaling pathway
GO:0019941	0.930	modification-dependent protein catabolic process
GO:0042176	0.919	regulation of protein catabolic process
GO:0016043	0.917	cellular component organization
GO:0061136	0.909	regulation of proteasomal protein catabolic process
GO:0051179	0.905	localization
GO:0050821	0.900	protein stabilization
GO:0051234	0.894	establishment of localization
GO:0048583	0.892	regulation of response to stimulus
GO:0048522	0.890	positive regulation of cellular process
GO:0031323	0.866	regulation of cellular metabolic process
GO:0006511	0.847	ubiquitin-dependent protein catabolic process
GO:0010033	0.828	response to organic substance
GO:0051641	0.807	cellular localization
GO:0048519	0.786	negative regulation of biological process
GO:0048523	0.772	negative regulation of cellular process
GO:0006996	0.743	organelle organization
GO:0008104	0.715	protein localization
GO:0009893	0.713	positive regulation of metabolic process
GO:0036211	0.695	protein modification process
GO:0006810	0.655	transport
GO:0010604	0.629	positive regulation of macromolecule metabolic process
GO:0080134	0.624	regulation of response to stress
GO:0048584	0.614	positive regulation of response to stimulus
GO:0051649	0.591	establishment of localization in cell
GO:0051173	0.581	positive regulation of nitrogen compound metabolic process
GO:0043161	0.565	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0042127	0.518	regulation of cell population proliferation
GO:0045184	0.506	establishment of protein localization
GO:0031329	0.504	regulation of cellular catabolic process
GO:0010243	0.463	response to organonitrogen compound
GO:0080135	0.456	regulation of cellular response to stress
GO:0046907	0.443	intracellular transport
GO:0002376	0.439	immune system process
GO:0061024	0.432	membrane organization
GO:0070887	0.414	cellular response to chemical stimulus
GO:0033365	0.410	protein localization to organelle
GO:0036503	0.402	ERAD pathway
GO:0071310	0.393	cellular response to organic substance
GO:0090150	0.386	establishment of protein localization to membrane
GO:1905897	0.381	regulation of response to endoplasmic reticulum stress
GO:0010256	0.373	endomembrane system organization
GO:0030433	0.371	ubiquitin-dependent ERAD pathway
GO:0051205	0.367	protein insertion into membrane
GO:1905898	0.365	positive regulation of response to endoplasmic reticulum stress
GO:0045048	0.354	protein insertion into ER membrane
GO:0006974	0.350	cellular response to DNA damage stimulus
GO:0051247	0.346	positive regulation of protein metabolic process
GO:0071705	0.339	nitrogen compound transport
GO:2000058	0.336	regulation of ubiquitin-dependent protein catabolic process
GO:0071702	0.335	organic substance transport
GO:0009896	0.332	positive regulation of catabolic process
GO:0002682	0.331	regulation of immune system process
GO:0042771	0.330	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0045862	0.327	positive regulation of proteolysis
GO:0009892	0.318	negative regulation of metabolic process
GO:0032434	0.318	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0010605	0.309	negative regulation of macromolecule metabolic process
GO:0045732	0.309	positive regulation of protein catabolic process
GO:0050776	0.307	regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.998	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0016020	0.735	membrane
GO:0032991	0.548	protein-containing complex
GO:0071818	0.390	BAT3 complex
GO:0070062	0.321	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]