StarFunc result for job id P46527

User Input

>input (198 residues)
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46527	1.000	1.000	3.198E-30	198	1.000	1.000	P46527.pdb.gz	CDN1B_HUMAN Cyclin-dependent kinase inhibitor 1B OS=Homo sapiens OX=9606 GN=CDKN1B PE=1 SV=1
2	AFDB:O08769	0.738	0.741	2.163E-25	197	0.864	0.868	O08769.pdb.gz	O08769_RAT Cyclin dependent kinase inhibitor OS=Rattus norvegicus OX=10116 GN=Cdkn1b PE=1 SV=1
3	PDB:7b5lP	0.303	0.695	9.536E-10	77	0.338	0.870	7b5lP.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
4	AFDB:Q6IQT7	0.348	0.327	3.282E-8	212	0.293	0.274	Q6IQT7.pdb.gz	Q6IQT7_DANRE Cyclin-dependent kinase inhibitor 1C OS=Danio rerio OX=7955 GN=cdkn1c PE=2 SV=1
5	AFDB:Q64315	0.343	0.412	2.356E-7	164	0.232	0.280	Q64315.pdb.gz	Q64315_RAT Cyclin-dependent kinase inhibitor 1A OS=Rattus norvegicus OX=10116 GN=Cdkn1a PE=2 SV=1
6	AFDB:A0A024RCX5	0.335	0.402	1.369E-6	164	0.217	0.262	A0A024RCX5.pdb.gz
7	AFDB:Q69DC1	0.330	0.188	1.131E-5	355	0.298	0.166	Q69DC1.pdb.gz	Q69DC1_RAT Cyclin-dependent kinase inhibitor 1C OS=Rattus norvegicus OX=10116 GN=Cdkn1c PE=3 SV=1
8	AFDB:P49918	0.333	0.213	1.608E-5	316	0.288	0.180	P49918.pdb.gz	CDN1C_HUMAN Cyclin-dependent kinase inhibitor 1C OS=Homo sapiens OX=9606 GN=CDKN1C PE=1 SV=1
9	AFDB:Q22197	0.338	0.361	3.031E-5	184	0.217	0.234	Q22197.pdb.gz	CKI1_CAEEL Cyclin-dependent kinase inhibitor 1 OS=Caenorhabditis elegans OX=6239 GN=cki-1 PE=1 SV=1
10	AFDB:G5EEJ2	0.338	0.262	4.016E-5	259	0.268	0.205	G5EEJ2.pdb.gz	G5EEJ2_CAEEL Cyclin-dependent kinase inhibitor OS=Caenorhabditis elegans OX=6239 GN=cki-2 PE=1 SV=1
11	AFDB:Q76P38	0.120	0.069	2.481E-1	398	0.136	0.068	Q76P38.pdb.gz	Q76P38_DICDI Lis-interacting protein OS=Dictyostelium discoideum OX=44689 GN=nudE PE=3 SV=1
12	PDB:6bk8E	0.154	0.164	6.657	186	0.106	0.113	6bk8E.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
13	PDB:6ft6u	0.116	0.150	7.663	150	0.035	0.047	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
14	PDB:7a6hQ	0.126	0.209	7.663	104	0.091	0.173	7a6hQ.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
15	PDB:7aavv	0.139	0.134	8.222	206	0.081	0.078	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
16	PDB:6j6gc	0.135	0.065	9.465	436	0.061	0.028	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P46527	6.02e-148	410	198	1.000	1.000	CDN1B_HUMAN Cyclin-dependent kinase inhibitor 1B OS=Homo sapiens OX=9606 GN=CDKN1B PE=1 SV=1
2	Q6I9V6	6.02e-148	410	198	1.000	1.000	Q6I9V6_HUMAN CDKN1B protein OS=Homo sapiens OX=9606 GN=CDKN1B PE=2 SV=1
3	Q96TE0	5.72e-146	405	198	0.990	0.990	Q96TE0_HUMAN Cdk inhibitor p27KIP1 OS=Homo sapiens OX=9606 PE=1 SV=1
4	P46414	4.04e-127	357	197	0.869	0.873	CDN1B_MOUSE Cyclin-dependent kinase inhibitor 1B OS=Mus musculus OX=10090 GN=Cdkn1b PE=1 SV=2
5	O08769	6.47e-126	354	197	0.864	0.868	O08769_RAT Cyclin dependent kinase inhibitor OS=Rattus norvegicus OX=10116 GN=Cdkn1b PE=1 SV=1
6	O43806	2.44e-116	329	158	0.793	0.994	O43806_HUMAN p27 kip1 protein (Fragment) OS=Homo sapiens OX=9606 GN=p27 kip1 PE=1 SV=1
7	Q6IQT7	5.97e-19	82.8	212	0.197	0.184	Q6IQT7_DANRE Cyclin-dependent kinase inhibitor 1C OS=Danio rerio OX=7955 GN=cdkn1c PE=2 SV=1
8	P49918	1.52e-16	78.2	316	0.247	0.155	CDN1C_HUMAN Cyclin-dependent kinase inhibitor 1C OS=Homo sapiens OX=9606 GN=CDKN1C PE=1 SV=1
9	Q91603	2.35e-16	75.9	210	0.136	0.129	Q91603_XENLA XICL OS=Xenopus laevis OX=8355 GN=Xicl PE=2 SV=1
10	A0A8I5ZZ18	4.45e-15	71.6	169	0.197	0.231	A0A8I5ZZ18_RAT Cyclin-dependent kinase inhibitor 1A OS=Rattus norvegicus OX=10116 GN=Cdkn1a PE=3 SV=1
11	Q69DC0	4.81e-15	74.3	343	0.187	0.108	Q69DC0_RAT CDKI protein OS=Rattus norvegicus OX=10116 GN=Cdkn1c PE=2 SV=1
12	P49919	5.31e-15	73.9	348	0.187	0.106	CDN1C_MOUSE Cyclin-dependent kinase inhibitor 1C OS=Mus musculus OX=10090 GN=Cdkn1c PE=1 SV=2
13	Q69DC1	5.69e-15	73.9	355	0.187	0.104	Q69DC1_RAT Cyclin-dependent kinase inhibitor 1C OS=Rattus norvegicus OX=10116 GN=Cdkn1c PE=3 SV=1
14	Q64315	6.15e-15	71.2	164	0.197	0.238	Q64315_RAT Cyclin-dependent kinase inhibitor 1A OS=Rattus norvegicus OX=10116 GN=Cdkn1a PE=2 SV=1
15	P38936	1.66e-13	67.4	164	0.152	0.183	CDN1A_HUMAN Cyclin-dependent kinase inhibitor 1 OS=Homo sapiens OX=9606 GN=CDKN1A PE=1 SV=3
16	P39689	2.48e-13	66.6	159	0.187	0.233	CDN1A_MOUSE Cyclin-dependent kinase inhibitor 1 OS=Mus musculus OX=10090 GN=Cdkn1a PE=1 SV=4
17	Q564P6	2.48e-13	66.6	159	0.187	0.233	Q564P6_MOUSE Cyclin-dependent kinase inhibitor 1A variant 1 OS=Mus musculus OX=10090 GN=Cdkn1a PE=2 SV=1
18	A5WWG2	1.22e-09	56.6	154	0.146	0.188	A5WWG2_DANRE Cyclin-dependent kinase inhibitor 1 OS=Danio rerio OX=7955 GN=cip1 PE=2 SV=1
19	U4PBK8	4.98e-09	55.5	175	0.212	0.240	U4PBK8_CAEEL Cyclin-dependent kinase inhibitor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cki-2 PE=1 SV=1
20	Q22198	5.16e-09	56.6	258	0.212	0.163	Q22198_CAEEL Cyclin-dependent kinase inhibitor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cki-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02234 CDI	2.5e-18	77.3	Cyclin-dependent kinase inhibitor
2	PF13447 Multi-haem_cyto	86	13.8	Seven times multi-haem cytochrome CxxCH

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228872

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227507	0.999	G1/S-specific cyclin-D1
2	9606.ENSP00000257904	0.999	Cyclin-dependent kinase 4
3	9606.ENSP00000262643	0.999	G1/S-specific cyclin-E1
4	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
5	9606.ENSP00000274026	0.999	Cyclin-A2
6	9606.ENSP00000265734	0.998	Cyclin-dependent kinase 6
7	9606.ENSP00000274255	0.998	S-phase kinase-associated protein 2
8	9606.ENSP00000384863	0.998	Exportin-1
9	9606.ENSP00000400175	0.998	Transforming protein RhoA
10	9606.ENSP00000451828	0.996	RAC-alpha serine/threonine-protein kinase
11	9606.ENSP00000255465	0.994	Cyclin-A1
12	9606.ENSP00000362082	0.994	G1/S-specific cyclin-D3
13	9606.ENSP00000429089	0.994	G1/S-specific cyclin-E2
14	9606.ENSP00000261254	0.993	G1/S-specific cyclin-D2
15	9606.ENSP00000350512	0.993	COP9 signalosome complex subunit 5
16	9606.ENSP00000311083	0.990	Cyclin-dependent kinases regulatory subunit 1
17	9606.ENSP00000364589	0.988	Cullin-4A
18	9606.ENSP00000385824	0.983	Forkhead box protein O3
19	9606.ENSP00000419782	0.981	Cyclin-dependent-like kinase 5
20	9606.ENSP00000378699	0.977	Cyclin-dependent kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0044877	0.995	protein-containing complex binding
GO:0004861	0.993	cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0019899	0.946	enzyme binding
GO:0030332	0.945	cyclin binding
GO:0098772	0.740	molecular function regulator activity
GO:0019210	0.667	kinase inhibitor activity
GO:0019900	0.646	kinase binding
GO:0019901	0.612	protein kinase binding
GO:0019887	0.603	protein kinase regulator activity
GO:0004860	0.593	protein kinase inhibitor activity
GO:0044389	0.588	ubiquitin-like protein ligase binding
GO:0140677	0.565	molecular function activator activity
GO:0031625	0.556	ubiquitin protein ligase binding
GO:0097027	0.534	ubiquitin-protein transferase activator activity
GO:0019902	0.521	phosphatase binding
GO:0019903	0.514	protein phosphatase binding
GO:0060090	0.513	molecular adaptor activity
GO:1990757	0.317	ubiquitin ligase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.994	response to stimulus
GO:0080090	0.992	regulation of primary metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0051726	0.991	regulation of cell cycle
GO:0048523	0.989	negative regulation of cellular process
GO:0048518	0.980	positive regulation of biological process
GO:0010941	0.976	regulation of cell death
GO:0009892	0.976	negative regulation of metabolic process
GO:0010563	0.972	negative regulation of phosphorus metabolic process
GO:1904029	0.971	regulation of cyclin-dependent protein kinase activity
GO:0009893	0.965	positive regulation of metabolic process
GO:0051716	0.964	cellular response to stimulus
GO:0006469	0.961	negative regulation of protein kinase activity
GO:0000079	0.950	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0007154	0.941	cell communication
GO:0045786	0.941	negative regulation of cell cycle
GO:0042127	0.939	regulation of cell population proliferation
GO:0071901	0.937	negative regulation of protein serine/threonine kinase activity
GO:0048522	0.933	positive regulation of cellular process
GO:0033554	0.930	cellular response to stress
GO:0023052	0.925	signaling
GO:0008219	0.921	cell death
GO:0008285	0.919	negative regulation of cell population proliferation
GO:0010604	0.910	positive regulation of macromolecule metabolic process
GO:0051173	0.907	positive regulation of nitrogen compound metabolic process
GO:1903047	0.904	mitotic cell cycle process
GO:0042221	0.903	response to chemical
GO:0051247	0.898	positive regulation of protein metabolic process
GO:0007165	0.857	signal transduction
GO:0051128	0.822	regulation of cellular component organization
GO:0010564	0.817	regulation of cell cycle process
GO:0031325	0.817	positive regulation of cellular metabolic process
GO:0007346	0.816	regulation of mitotic cell cycle
GO:0012501	0.813	programmed cell death
GO:0008152	0.810	metabolic process
GO:0070887	0.801	cellular response to chemical stimulus
GO:1904705	0.743	regulation of vascular associated smooth muscle cell proliferation
GO:0048662	0.664	negative regulation of smooth muscle cell proliferation
GO:1901700	0.655	response to oxygen-containing compound
GO:0044237	0.607	cellular metabolic process
GO:0010035	0.592	response to inorganic substance
GO:0019219	0.502	regulation of nucleobase-containing compound metabolic process
GO:0051179	0.494	localization
GO:0010468	0.482	regulation of gene expression
GO:0009889	0.478	regulation of biosynthetic process
GO:0010556	0.474	regulation of macromolecule biosynthetic process
GO:0031326	0.474	regulation of cellular biosynthetic process
GO:0051252	0.456	regulation of RNA metabolic process
GO:0044770	0.449	cell cycle phase transition
GO:0006355	0.447	regulation of DNA-templated transcription
GO:0044772	0.438	mitotic cell cycle phase transition
GO:0032502	0.423	developmental process
GO:0071704	0.418	organic substance metabolic process
GO:0042981	0.418	regulation of apoptotic process
GO:0035556	0.387	intracellular signal transduction
GO:0048856	0.376	anatomical structure development
GO:0010033	0.371	response to organic substance
GO:0032501	0.350	multicellular organismal process
GO:0045934	0.345	negative regulation of nucleobase-containing compound metabolic process
GO:1901990	0.332	regulation of mitotic cell cycle phase transition
GO:0044843	0.323	cell cycle G1/S phase transition
GO:0044093	0.314	positive regulation of molecular function
GO:0023051	0.307	regulation of signaling
GO:0010646	0.304	regulation of cell communication
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.994	protein-containing complex
GO:0005829	0.994	cytosol
GO:0140535	0.424	intracellular protein-containing complex
GO:1990234	0.410	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]