StarFunc result for job id P46531

User Input

>input (2555 residues)
MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDP
NPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVN
ECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVT
HECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMP
GYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC
ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKID
GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNEC
NSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRN
GGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYS
GRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANC
TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH
DVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQ
YRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGS
YCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLD
LPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGG
TCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG
PECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDI
PPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYY
GREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEI
DNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVA
AAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA
SDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAP
TPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRK
PSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVAS
GTSTVLGSSSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAP
SLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPA
NIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQE
SPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQW
SSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QZF2	0.148	0.152	0.000	2468	0.527	0.546	F1QZF2.pdb.gz
2	AFDB:P46530	0.137	0.142	0.000	2437	0.668	0.701	P46530.pdb.gz	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
3	AFDB:P46531	1.000	1.000	0.000	2555	1.000	1.000	P46531.pdb.gz	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
4	AFDB:Q9UM47	0.150	0.163	0.000	2321	0.476	0.524	Q9UM47.pdb.gz	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
5	AFDB:P10041	0.039	0.098	2.193E-25	833	0.059	0.181	P10041.pdb.gz	DL_DROME Neurogenic locus protein delta OS=Drosophila melanogaster OX=7227 GN=Delta PE=1 SV=2
6	AFDB:Q9Y575	0.085	0.410	1.215E-12	518	0.025	0.125	Q9Y575.pdb.gz	ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens OX=9606 GN=ASB3 PE=1 SV=1
7	PDB:8cs9A	0.087	0.277	1.703E-12	796	0.028	0.090	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
8	AFDB:Q68DC2	0.048	0.130	5.255E-12	871	0.053	0.155	Q68DC2.pdb.gz	ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKS6 PE=1 SV=2
9	AFDB:O75179	0.070	0.069	7.871E-12	2603	0.071	0.070	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
10	AFDB:P0C6S7	0.094	0.180	6.905E-11	1260	0.051	0.104	P0C6S7.pdb.gz	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
11	PDB:2dvwA	0.078	0.808	7.519E-11	229	0.023	0.258	2dvwA.pdb.gz
12	PDB:5vkqA	0.089	0.146	1.310E-10	1499	0.028	0.047	5vkqA.pdb.gz
13	AFDB:Q9BZL4	0.059	0.134	1.400E-10	782	0.055	0.180	Q9BZL4.pdb.gz	PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C PE=1 SV=1
14	PDB:4oauC	0.070	0.219	5.502E-9	692	0.024	0.088	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:6v9hC	0.082	0.692	3.944E-8	270	0.019	0.178	6v9hC.pdb.gz
16	PDB:1wg0A	0.084	0.755	4.827E-8	243	0.024	0.255	1wg0A.pdb.gz
17	PDB:6jd6B	0.061	0.725	1.198E-7	192	0.018	0.245	6jd6B.pdb.gz
18	PDB:6aunA	0.082	0.317	2.555E-7	618	0.025	0.105	6aunA.pdb.gz
19	PDB:6mwqA	0.057	0.288	6.343E-7	493	0.020	0.101	6mwqA.pdb.gz
20	PDB:6e2fC	0.077	0.274	2.886E-6	647	0.024	0.096	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0PGH6	2986	2465	0.607	0.630	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
2	A2RUV0	3798	2522	0.744	0.754	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
3	B8JI71	654	2904	0.164	0.145	EYS_DANRE Protein eyes shut homolog OS=Danio rerio OX=7955 GN=eys PE=1 SV=2
4	F1RCH4	2304	2475	0.503	0.520	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
5	G3I6Z6	4589	2527	0.892	0.902	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
6	O35516	2564	2473	0.537	0.555	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
7	P07207	1979	2703	0.413	0.391	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
8	P21783	3792	2524	0.741	0.750	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
9	P31695	1007	1964	0.268	0.349	NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus OX=10090 GN=Notch4 PE=1 SV=3
10	P46530	3332	2437	0.672	0.704	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
11	P46531	5197	2555	1.000	1.000	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
12	Q01705	4632	2531	0.901	0.909	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
13	Q04721	2576	2471	0.535	0.554	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
14	Q07008	4660	2531	0.900	0.908	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
15	Q61982	1157	2318	0.248	0.273	NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1
16	Q800E4	2518	2468	0.528	0.547	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
17	Q99466	1120	2003	0.290	0.370	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
18	Q9QW30	2550	2471	0.536	0.554	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
19	Q9R172	1155	2319	0.249	0.274	NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus OX=10116 GN=Notch3 PE=2 SV=2
20	Q9UM47	1163	2321	0.250	0.275	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.9e-22	89.9	Ankyrin repeat
2	PF12796 Ank_2	3.6e-26	102.9	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	8.1e-14	61.2	Ankyrin repeat
4	PF13637 Ank_4	1.4e-14	65.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.4e-18	77.9	Ankyrin repeats (many copies)
6	PF00008 EGF	2.9e-197	649.4	EGF-like domain
7	PF07974 EGF_2	5.7e-28	108.3	EGF-like domain
8	PF12947 EGF_3	0.0054	28.2	EGF domain
9	PF07645 EGF_CA	2.9e-47	169.9	Calcium-binding EGF domain
10	PF12661 hEGF	8.3e-117	389.6	Human growth factor-like EGF
11	PF06816 NOD	1.5e-23	93.3	NOTCH protein
12	PF07684 NODP	2.6e-20	83.5	NOTCH protein
13	PF00066 Notch	3.7e-23	93.0	LNR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000277541

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292599	0.999	Mastermind-like protein 1
2	9606.ENSP00000326366	0.999	Presenilin-1
3	9606.ENSP00000345206	0.999	Recombining binding protein suppressor of hairless
4	9606.ENSP00000451300	0.999	Protein numb homolog
5	9606.ENSP00000281708	0.998	F-box/WD repeat-containing protein 7
6	9606.ENSP00000344456	0.998	Catenin beta-1
7	9606.ENSP00000437955	0.998	Hypoxia-inducible factor 1-alpha
8	9606.ENSP00000263253	0.997	Histone acetyltransferase p300
9	9606.ENSP00000257600	0.996	E3 ubiquitin-protein ligase DTX1
10	9606.ENSP00000260408	0.996	Disintegrin and metalloproteinase domain-containing protein 10
11	9606.ENSP00000407822	0.996	Contactin-6
12	9606.ENSP00000254958	0.994	Protein jagged-1
13	9606.ENSP00000479618	0.994	Myc proto-oncogene protein
14	9606.ENSP00000294785	0.991	Nicastrin
15	9606.ENSP00000332973	0.991	Mothers against decapentaplegic homolog 3
16	9606.ENSP00000259526	0.989	Protein NOV homolog
17	9606.ENSP00000338272	0.989	Hairy/enhancer-of-split related with YRPW motif protein 1
18	9606.ENSP00000379258	0.989	Transcriptional activator GLI3
19	9606.ENSP00000480421	0.989	Serrate RNA effector molecule homolog
20	9606.ENSP00000284981	0.988	Amyloid-beta A4 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0003713	0.997	transcription coactivator activity
GO:0042802	0.974	identical protein binding
GO:0019899	0.560	enzyme binding
GO:0008134	0.529	transcription factor binding
GO:0061629	0.358	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0051716	0.978	cellular response to stimulus
GO:0048731	0.976	system development
GO:0048513	0.970	animal organ development
GO:0007165	0.970	signal transduction
GO:0009653	0.965	anatomical structure morphogenesis
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0007166	0.960	cell surface receptor signaling pathway
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0080090	0.955	regulation of primary metabolic process
GO:0031323	0.953	regulation of cellular metabolic process
GO:0048522	0.948	positive regulation of cellular process
GO:0048519	0.935	negative regulation of biological process
GO:0048869	0.918	cellular developmental process
GO:0007219	0.909	Notch signaling pathway
GO:0010468	0.905	regulation of gene expression
GO:0009893	0.903	positive regulation of metabolic process
GO:0030154	0.901	cell differentiation
GO:0010604	0.888	positive regulation of macromolecule metabolic process
GO:0048523	0.885	negative regulation of cellular process
GO:0051173	0.857	positive regulation of nitrogen compound metabolic process
GO:0051241	0.836	negative regulation of multicellular organismal process
GO:0007399	0.835	nervous system development
GO:0042127	0.828	regulation of cell population proliferation
GO:0060411	0.828	cardiac septum morphogenesis
GO:0042221	0.820	response to chemical
GO:0009890	0.810	negative regulation of biosynthetic process
GO:0009966	0.804	regulation of signal transduction
GO:0031325	0.802	positive regulation of cellular metabolic process
GO:0010605	0.801	negative regulation of macromolecule metabolic process
GO:0003179	0.798	heart valve morphogenesis
GO:2000026	0.795	regulation of multicellular organismal development
GO:0051172	0.792	negative regulation of nitrogen compound metabolic process
GO:0060840	0.791	artery development
GO:0031327	0.790	negative regulation of cellular biosynthetic process
GO:1902679	0.778	negative regulation of RNA biosynthetic process
GO:0008284	0.771	positive regulation of cell population proliferation
GO:0048584	0.767	positive regulation of response to stimulus
GO:1903507	0.760	negative regulation of nucleic acid-templated transcription
GO:0006357	0.758	regulation of transcription by RNA polymerase II
GO:0045935	0.757	positive regulation of nucleobase-containing compound metabolic process
GO:0048468	0.755	cell development
GO:0061311	0.754	cell surface receptor signaling pathway involved in heart development
GO:0060322	0.752	head development
GO:0003231	0.750	cardiac ventricle development
GO:0010557	0.749	positive regulation of macromolecule biosynthetic process
GO:0051254	0.749	positive regulation of RNA metabolic process
GO:1902680	0.741	positive regulation of RNA biosynthetic process
GO:0045892	0.740	negative regulation of DNA-templated transcription
GO:0003281	0.734	ventricular septum development
GO:1903508	0.733	positive regulation of nucleic acid-templated transcription
GO:0006950	0.726	response to stress
GO:0009719	0.721	response to endogenous stimulus
GO:0010033	0.720	response to organic substance
GO:0009888	0.714	tissue development
GO:0045893	0.711	positive regulation of DNA-templated transcription
GO:0060548	0.700	negative regulation of cell death
GO:0045165	0.696	cell fate commitment
GO:0023056	0.694	positive regulation of signaling
GO:0010647	0.694	positive regulation of cell communication
GO:0043066	0.689	negative regulation of apoptotic process
GO:0060485	0.687	mesenchyme development
GO:0009967	0.674	positive regulation of signal transduction
GO:0003230	0.670	cardiac atrium development
GO:0071495	0.669	cellular response to endogenous stimulus
GO:0042246	0.655	tissue regeneration
GO:0051093	0.653	negative regulation of developmental process
GO:0045944	0.653	positive regulation of transcription by RNA polymerase II
GO:0045595	0.631	regulation of cell differentiation
GO:0060284	0.624	regulation of cell development
GO:1901700	0.618	response to oxygen-containing compound
GO:0070887	0.608	cellular response to chemical stimulus
GO:0045596	0.605	negative regulation of cell differentiation
GO:0050767	0.604	regulation of neurogenesis
GO:1902531	0.601	regulation of intracellular signal transduction
GO:0022008	0.600	neurogenesis
GO:1905314	0.558	semi-lunar valve development
GO:0060429	0.557	epithelium development
GO:0009605	0.555	response to external stimulus
GO:0048585	0.544	negative regulation of response to stimulus
GO:0070848	0.529	response to growth factor
GO:0097150	0.500	neuronal stem cell population maintenance
GO:0007417	0.499	central nervous system development
GO:0008285	0.497	negative regulation of cell population proliferation
GO:0048732	0.443	gland development
GO:0035239	0.417	tube morphogenesis
GO:0048646	0.415	anatomical structure formation involved in morphogenesis
GO:0071840	0.371	cellular component organization or biogenesis
GO:0009607	0.335	response to biotic stimulus
GO:0016043	0.327	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0005654	0.996	nucleoplasm
GO:0005576	0.989	extracellular region
GO:0005829	0.989	cytosol
GO:0031090	0.949	organelle membrane
GO:0005794	0.906	Golgi apparatus
GO:0098588	0.880	bounding membrane of organelle
GO:0032991	0.879	protein-containing complex
GO:0031982	0.759	vesicle
GO:0005783	0.530	endoplasmic reticulum
GO:0000139	0.500	Golgi membrane
GO:0031984	0.425	organelle subcompartment
GO:0005789	0.385	endoplasmic reticulum membrane
GO:0002193	0.378	MAML1-RBP-Jkappa- ICN1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]