StarFunc result for job id P46734

User Input

>input (347 residues)
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1H230	0.871	0.871	2.055E-59	347	0.965	0.965	B1H230.pdb.gz	B1H230_RAT Map2k3 protein OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=2 SV=1
2	AFDB:Q9DGE0	0.878	0.845	3.988E-53	361	0.772	0.742	Q9DGE0.pdb.gz	MP2K6_DANRE Dual specificity mitogen-activated protein kinase kinase 6 OS=Danio rerio OX=7955 GN=map2k6 PE=1 SV=2
3	AFDB:A8K3Y2	0.860	0.892	1.664E-51	334	0.772	0.802	A8K3Y2.pdb.gz	A8K3Y2_HUMAN Mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=2 SV=1
4	AFDB:Q9I959	0.848	0.731	1.692E-49	404	0.769	0.661	Q9I959.pdb.gz	Q9I959_CYPCA MAP kinase kinase 6 (MKK6) OS=Cyprinus carpio OX=7962 PE=2 SV=1
5	AFDB:Q9U983	0.820	0.849	2.772E-40	335	0.568	0.588	Q9U983.pdb.gz	Q9U983_DROME MAPKK OS=Drosophila melanogaster OX=7227 GN=lic PE=2 SV=1
6	AFDB:B1NA68	0.851	0.733	1.367E-38	404	0.499	0.428	B1NA68.pdb.gz	B1NA68_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=map2k4A PE=1 SV=1
7	AFDB:S4VP54	0.844	0.720	1.806E-38	408	0.513	0.436	S4VP54.pdb.gz	S4VP54_RAT MAP2K4delta OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
8	AFDB:G5EDF7	0.849	0.876	2.522E-38	336	0.464	0.479	G5EDF7.pdb.gz	SEK1_CAEEL Dual specificity mitogen-activated protein kinase kinase sek-1 OS=Caenorhabditis elegans OX=6239 GN=sek-1 PE=1 SV=1
9	AFDB:A4UU31	0.846	0.707	3.332E-38	417	0.496	0.412	A4UU31.pdb.gz	A4UU31_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=MKK4B PE=1 SV=1
10	AFDB:O61444	0.833	0.684	1.554E-36	424	0.481	0.394	O61444.pdb.gz	O61444_DROME MAP kinase kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Mkk4 PE=1 SV=1
11	PDB:8a8mB	0.715	0.822	1.198E-34	298	0.686	0.799	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
12	PDB:3eqdA	0.750	0.823	4.794E-28	315	0.337	0.371	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
13	PDB:5eymA	0.702	0.829	2.034E-24	292	0.323	0.384	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
14	PDB:4ek6A	0.605	0.744	1.712E-18	279	0.205	0.254	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
15	PDB:6s73A	0.667	0.848	2.673E-18	269	0.210	0.271	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:3coiA	0.566	0.571	1.679E-17	344	0.216	0.218	3coiA.pdb.gz
17	PDB:4eomC	0.611	0.756	2.346E-17	276	0.196	0.246	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
18	PDB:1jnkA	0.591	0.593	1.055E-16	346	0.210	0.211	1jnkA.pdb.gz	Crystal structure of JNK3: a kinase implicated in neuronal apoptosis.
19	PDB:4yc3A	0.619	0.719	1.179E-16	295	0.184	0.217	4yc3A.pdb.gz
20	PDB:4gcjA	0.609	0.690	1.318E-16	304	0.205	0.234	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K3Y2	0.0	556	334	0.772	0.802	A8K3Y2_HUMAN Mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=2 SV=1
2	B1H230	0.0	705	347	0.965	0.965	B1H230_RAT Map2k3 protein OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=2 SV=1
3	F7EXM7	0.0	683	340	0.942	0.962	F7EXM7_RAT Mitogen activated protein kinase kinase 3 OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=1 SV=1
4	M0R7E7	0.0	704	419	0.965	0.800	M0R7E7_RAT Mitogen activated protein kinase kinase 3 OS=Rattus norvegicus OX=10116 GN=Map2k3 PE=1 SV=1
5	O09110	0.0	705	347	0.965	0.965	MP2K3_MOUSE Dual specificity mitogen-activated protein kinase kinase 3 OS=Mus musculus OX=10090 GN=Map2k3 PE=1 SV=2
6	P46734	0.0	725	347	1.000	1.000	MP2K3_HUMAN Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP2K3 PE=1 SV=2
7	P52564	0.0	556	334	0.772	0.802	MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=1 SV=1
8	P70236	0.0	551	334	0.761	0.790	MP2K6_MOUSE Dual specificity mitogen-activated protein kinase kinase 6 OS=Mus musculus OX=10090 GN=Map2k6 PE=1 SV=1
9	Q925D6	0.0	550	334	0.761	0.790	Q925D6_RAT Mitogen-activated protein kinase kinase 6 OS=Rattus norvegicus OX=10116 GN=Map2k6 PE=1 SV=1
10	Q9DGE0	0.0	559	361	0.746	0.717	MP2K6_DANRE Dual specificity mitogen-activated protein kinase kinase 6 OS=Danio rerio OX=7955 GN=map2k6 PE=1 SV=2
11	Q9I959	0.0	564	404	0.752	0.646	Q9I959_CYPCA MAP kinase kinase 6 (MKK6) OS=Cyprinus carpio OX=7962 PE=2 SV=1
12	Q9U983	4.84e-147	420	335	0.571	0.591	Q9U983_DROME MAPKK OS=Drosophila melanogaster OX=7227 GN=lic PE=2 SV=1
13	O62602	3.94e-146	417	334	0.568	0.590	O62602_DROME Licorne OS=Drosophila melanogaster OX=7227 GN=lic PE=1 SV=1
14	B1NA68	6.16e-120	353	404	0.467	0.401	B1NA68_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=map2k4A PE=1 SV=1
15	P45985	1.08e-119	353	399	0.524	0.456	MP2K4_HUMAN Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1
16	P47809	2.71e-119	352	397	0.473	0.413	MP2K4_MOUSE Dual specificity mitogen-activated protein kinase kinase 4 OS=Mus musculus OX=10090 GN=Map2k4 PE=1 SV=2
17	Q4KSH6	2.71e-119	352	397	0.473	0.413	Q4KSH6_RAT Dual specificity mitogen-activated protein kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
18	F1LP57	3.04e-119	350	371	0.473	0.442	F1LP57_RAT Mitogen activated protein kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=4
19	S4VP54	3.11e-119	352	408	0.473	0.402	S4VP54_RAT MAP2K4delta OS=Rattus norvegicus OX=10116 GN=Map2k4 PE=1 SV=1
20	A4UU31	7.23e-117	346	417	0.473	0.393	A4UU31_DANRE Dual specificity mitogen-activated protein kinase kinase 4 OS=Danio rerio OX=7955 GN=MKK4B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	3	18.4	ABC1 atypical kinase-like domain
2	PF01636 APH	70	14.7	Phosphotransferase enzyme family
3	PF01633 Choline_kinase	1.5e+02	13.4	Choline/ethanolamine kinase
4	PF12330 Haspin_kinase	33	14.9	Haspin like kinase domain
5	PF14531 Kinase-like	0.012	26.6	Kinase-like
6	PF00069 Pkinase	3.1e-53	192.4	Protein kinase domain
7	PF17667 Pkinase_fungal	24	15.1	Fungal protein kinase
8	PF07714 PK_Tyr_Ser-Thr	2.5e-35	133.6	Protein tyrosine and serine/threonine kinase
9	PF01163 RIO1	3.1e+02	12.4	RIO1 family
10	PF07387 Seadorna_VP7	16	16.0	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010382075.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010387975.1	0.992	Mitogen-activated protein kinase 14
2	61622.XP_010356055.1	0.982	Mitogen-activated protein kinase kinase kinase 7 isoform X1
3	61622.XP_010371458.1	0.982	Mitogen-activated protein kinase kinase kinase 4
4	61622.XP_010377783.1	0.979	Mitogen-activated protein kinase kinase kinase 5
5	61622.XP_010359544.1	0.976	Mitogen-activated protein kinase 12
6	61622.XP_010385859.1	0.975	TAO kinase 2
7	61622.XP_010351423.1	0.974	Dual specificity mitogen-activated protein kinase kinase 6 isoform X1
8	61622.XP_010387980.1	0.974	Mitogen-activated protein kinase 13
9	61622.XP_010387580.1	0.961	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 isoform X1
10	61622.XP_010382026.1	0.956	Mitogen-activated protein kinase 8
11	61622.XP_010380076.1	0.952	Mitogen-activated protein kinase 1
12	61622.XP_010385672.1	0.952	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
13	61622.XP_010379330.1	0.948	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 isoform X1
14	61622.XP_010366274.1	0.944	TAO kinase 1
15	61622.XP_010378356.1	0.944	Mitogen-activated protein kinase kinase kinase 3
16	61622.XP_010366568.1	0.942	TAO kinase 3
17	61622.XP_010378719.1	0.942	Mitogen-activated protein kinase kinase kinase 6
18	61622.XP_010360102.1	0.940	Receptor-interacting serine/threonine-protein kinase 1 isoform X1
19	61622.XP_010353442.1	0.937	TNFRSF1A associated via death domain
20	61622.XP_010355134.1	0.937	Mitogen-activated protein kinase kinase kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004712	0.996	protein serine/threonine/tyrosine kinase activity
GO:0004674	0.962	protein serine/threonine kinase activity
GO:0004708	0.906	MAP kinase kinase activity
GO:0019899	0.803	enzyme binding
GO:0042802	0.310	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0048518	0.990	positive regulation of biological process
GO:0051716	0.987	cellular response to stimulus
GO:0009893	0.953	positive regulation of metabolic process
GO:0080090	0.948	regulation of primary metabolic process
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0031323	0.948	regulation of cellular metabolic process
GO:0006950	0.944	response to stress
GO:0010604	0.939	positive regulation of macromolecule metabolic process
GO:0032501	0.938	multicellular organismal process
GO:0051173	0.926	positive regulation of nitrogen compound metabolic process
GO:0000165	0.920	MAPK cascade
GO:0048522	0.917	positive regulation of cellular process
GO:0051174	0.873	regulation of phosphorus metabolic process
GO:0031401	0.873	positive regulation of protein modification process
GO:0031325	0.844	positive regulation of cellular metabolic process
GO:0042325	0.835	regulation of phosphorylation
GO:0048583	0.807	regulation of response to stimulus
GO:0023051	0.797	regulation of signaling
GO:1902531	0.788	regulation of intracellular signal transduction
GO:0008152	0.786	metabolic process
GO:0042221	0.729	response to chemical
GO:0045937	0.721	positive regulation of phosphate metabolic process
GO:0044237	0.697	cellular metabolic process
GO:0009889	0.689	regulation of biosynthetic process
GO:0001932	0.685	regulation of protein phosphorylation
GO:0071704	0.673	organic substance metabolic process
GO:0001934	0.669	positive regulation of protein phosphorylation
GO:0048584	0.667	positive regulation of response to stimulus
GO:0070887	0.659	cellular response to chemical stimulus
GO:0032502	0.658	developmental process
GO:0010033	0.651	response to organic substance
GO:0048856	0.635	anatomical structure development
GO:0071310	0.617	cellular response to organic substance
GO:0044238	0.603	primary metabolic process
GO:0010468	0.594	regulation of gene expression
GO:0006807	0.591	nitrogen compound metabolic process
GO:0010556	0.591	regulation of macromolecule biosynthetic process
GO:0043170	0.589	macromolecule metabolic process
GO:0023056	0.520	positive regulation of signaling
GO:0010647	0.520	positive regulation of cell communication
GO:0043412	0.512	macromolecule modification
GO:0019538	0.509	protein metabolic process
GO:1902533	0.501	positive regulation of intracellular signal transduction
GO:0036211	0.499	protein modification process
GO:0006793	0.490	phosphorus metabolic process
GO:0019219	0.488	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.487	regulation of cellular biosynthetic process
GO:0006796	0.481	phosphate-containing compound metabolic process
GO:0065009	0.469	regulation of molecular function
GO:0009605	0.446	response to external stimulus
GO:0048519	0.445	negative regulation of biological process
GO:0033554	0.440	cellular response to stress
GO:1901700	0.426	response to oxygen-containing compound
GO:0044093	0.425	positive regulation of molecular function
GO:1901701	0.422	cellular response to oxygen-containing compound
GO:0050790	0.398	regulation of catalytic activity
GO:0048523	0.395	negative regulation of cellular process
GO:0051252	0.389	regulation of RNA metabolic process
GO:0006355	0.378	regulation of DNA-templated transcription
GO:0007275	0.374	multicellular organism development
GO:0080134	0.365	regulation of response to stress
GO:0016310	0.343	phosphorylation
GO:0043085	0.328	positive regulation of catalytic activity
GO:0051239	0.325	regulation of multicellular organismal process
GO:0071216	0.323	cellular response to biotic stimulus
GO:0043408	0.321	regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0031974	0.947	membrane-enclosed lumen
GO:0005634	0.927	nucleus
GO:0070013	0.920	intracellular organelle lumen
GO:0031981	0.909	nuclear lumen
GO:0005654	0.851	nucleoplasm
GO:0016020	0.845	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.12.1	0.996	dual-specificity kinase.
EC:2.7.12.2	0.906	mitogen-activated protein kinase kinase.

[back to server]