StarFunc result for job id P46736

User Input

>input (316 residues)
MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMR
TVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGW
YHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQK
SSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILC
QEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQE
LQQEKEELMQELSSLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46736	1.000	1.000	2.208E-64	316	1.000	1.000	P46736.pdb.gz	BRCC3_HUMAN Lys-63-specific deubiquitinase BRCC36 OS=Homo sapiens OX=9606 GN=BRCC3 PE=1 SV=2
2	AFDB:P46737	0.899	0.975	3.214E-55	291	0.892	0.969	P46737.pdb.gz	BRCC3_MOUSE Lys-63-specific deubiquitinase BRCC36 OS=Mus musculus OX=10090 GN=Brcc3 PE=1 SV=1
3	AFDB:A0A0R4IER2	0.804	0.972	1.506E-46	261	0.731	0.885	A0A0R4IER2.pdb.gz
4	PDB:6gvwB	0.806	0.970	1.988E-44	262	0.816	0.985	6gvwB.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
5	AFDB:A0A0R4ICH2	0.669	0.840	1.473E-40	251	0.627	0.789	A0A0R4ICH2.pdb.gz
6	AFDB:Q8RW94	0.764	0.600	5.475E-29	406	0.392	0.305	Q8RW94.pdb.gz	Q8RW94_ARATH At1g80210/F18B13_28 OS=Arabidopsis thaliana OX=3702 GN=BRCC36A PE=1 SV=1
7	AFDB:F2Z540	0.431	0.399	7.319E-14	344	0.187	0.172	F2Z540.pdb.gz
8	AFDB:Q86IJ1	0.443	0.456	1.068E-13	306	0.203	0.209	Q86IJ1.pdb.gz	PSDE_DICDI 26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum OX=44689 GN=psmD14 PE=3 SV=1
9	AFDB:Q54PF3	0.414	0.396	1.558E-13	332	0.180	0.172	Q54PF3.pdb.gz	CSN5_DICDI COP9 signalosome complex subunit 5 OS=Dictyostelium discoideum OX=44689 GN=csn5 PE=1 SV=1
10	AFDB:P91001	0.422	0.367	4.269E-13	368	0.177	0.152	P91001.pdb.gz	CSN5_CAEEL COP9 signalosome complex subunit 5 OS=Caenorhabditis elegans OX=6239 GN=csn-5 PE=1 SV=1
11	AFDB:Q9XZ58	0.429	0.417	4.842E-13	327	0.187	0.180	Q9XZ58.pdb.gz	CSN5_DROME COP9 signalosome complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=CSN5 PE=1 SV=1
12	PDB:6r7fE	0.381	0.386	1.931E-11	311	0.187	0.190	6r7fE.pdb.gz
13	PDB:5l4kV	0.416	0.446	6.805E-11	293	0.203	0.218	5l4kV.pdb.gz
14	PDB:5mpbV	0.380	0.412	1.643E-10	289	0.180	0.197	5mpbV.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
15	PDB:5gjqV	0.413	0.499	2.398E-10	257	0.184	0.226	5gjqV.pdb.gz	An atomic structure of the human 26S proteasome.
16	PDB:3jckG	0.397	0.480	1.586E-9	257	0.174	0.214	3jckG.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
17	PDB:6j30U	0.360	0.424	1.050E-8	262	0.123	0.149	6j30U.pdb.gz	Structural Snapshots of 26S Proteasome Reveal Tetraubiquitin-Induced Conformations.
18	PDB:6h3cA	0.396	0.478	1.438E-8	255	0.130	0.161	6h3cA.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
19	PDB:6fvtU	0.380	0.393	1.970E-8	304	0.133	0.138	6fvtU.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
20	PDB:6oa9G	0.395	0.281	2.235E-8	468	0.142	0.096	6oa9G.pdb.gz	Substrate processing by the Cdc48 ATPase complex is initiated by ubiquitin unfolding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P46736	0.0	654	316	1.000	1.000	BRCC3_HUMAN Lys-63-specific deubiquitinase BRCC36 OS=Homo sapiens OX=9606 GN=BRCC3 PE=1 SV=2
2	P46737	0.0	576	291	0.896	0.973	BRCC3_MOUSE Lys-63-specific deubiquitinase BRCC36 OS=Mus musculus OX=10090 GN=Brcc3 PE=1 SV=1
3	Q8RW94	4.61e-50	173	406	0.278	0.217	Q8RW94_ARATH At1g80210/F18B13_28 OS=Arabidopsis thaliana OX=3702 GN=BRCC36A PE=1 SV=1
4	F4JC55	6.19e-50	172	405	0.278	0.217	F4JC55_ARATH Mov34/MPN/PAD-1 family protein OS=Arabidopsis thaliana OX=3702 GN=BRCC36B PE=1 SV=1
5	A3KNN5	1.95e-11	65.9	310	0.177	0.181	A3KNN5_DANRE 26S proteasome non-ATPase regulatory subunit 14 OS=Danio rerio OX=7955 GN=zgc:162272 PE=1 SV=1
6	A0A8I6AHX8	2.10e-11	65.5	285	0.177	0.196	A0A8I6AHX8_RAT Proteasome 26S subunit, non-ATPase 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
7	A0A0G2JZJ1	2.54e-11	65.5	306	0.177	0.183	A0A0G2JZJ1_RAT Proteasome 26S subunit, non-ATPase 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
8	Q9LT08	2.55e-11	65.5	308	0.158	0.162	PSDE_ARATH 26S proteasome non-ATPase regulatory subunit 14 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN11 PE=1 SV=1
9	Q86IJ1	2.57e-11	65.5	306	0.165	0.170	PSDE_DICDI 26S proteasome non-ATPase regulatory subunit 14 OS=Dictyostelium discoideum OX=44689 GN=psmD14 PE=3 SV=1
10	O00487	2.66e-11	65.5	310	0.177	0.181	PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 OS=Homo sapiens OX=9606 GN=PSMD14 PE=1 SV=1
11	O35593	2.66e-11	65.5	310	0.177	0.181	PSDE_MOUSE 26S proteasome non-ATPase regulatory subunit 14 OS=Mus musculus OX=10090 GN=Psmd14 PE=1 SV=2
12	Q17QP9	2.66e-11	65.5	310	0.177	0.181	Q17QP9_BOVIN Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Bos taurus OX=9913 GN=PSMD14 PE=1 SV=1
13	Q4V8E2	2.66e-11	65.5	310	0.177	0.181	Q4V8E2_RAT Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 14 OS=Rattus norvegicus OX=10116 GN=Psmd14 PE=1 SV=1
14	O76577	1.60e-10	63.2	312	0.171	0.173	PSDE_CAEEL 26S proteasome non-ATPase regulatory subunit 14 OS=Caenorhabditis elegans OX=6239 GN=rpn-11 PE=1 SV=1
15	Q9V3H2	1.85e-10	63.2	308	0.161	0.166	PSDE_DROME 26S proteasome non-ATPase regulatory subunit 14 OS=Drosophila melanogaster OX=7227 GN=Rpn11 PE=1 SV=1
16	P41878	9.66e-10	60.8	308	0.174	0.179	RPN11_SCHPO 26S proteasome regulatory subunit rpn11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn11 PE=1 SV=2
17	Q8WRU0	1.37e-09	60.5	305	0.171	0.177	Q8WRU0_9TRYP Proteasome regulatory non-ATP-ase subunit 11 OS=Trypanosoma brucei OX=5691 GN=Rpn11 PE=2 SV=1
18	Q38BU2	1.56e-09	60.5	305	0.171	0.177	Q38BU2_TRYB2 Proteasome regulatory non-ATPase subunit 11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4510 PE=4 SV=1
19	P43588	6.65e-09	58.5	306	0.149	0.154	RPN11_YEAST Ubiquitin carboxyl-terminal hydrolase RPN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN11 PE=1 SV=1
20	Q8LAZ7	5.76e-08	55.8	357	0.149	0.132	CSN5A_ARATH COP9 signalosome complex subunit 5a OS=Arabidopsis thaliana OX=3702 GN=CSN5A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	33	16.4	Apg6 coiled-coil region
2	PF18110 BRCC36_C	4.7e-27	105.3	BRCC36 C-terminal helical domain
3	PF19776 DUF6262	87	14.8	Family of unknown function (DUF6262)
4	PF01398 JAB	4.1e-42	154.3	JAB1/Mov34/MPN/PAD-1 ubiquitin protease
5	PF14464 Prok-JAB	0.0017	29.6	Prokaryotic homologs of the JAB domain
6	PF14970 TEDC1	3.6e+02	12.9	Tubulin epsilon and delta complex protein 1
7	PF03665 UPF0172	13	17.3	Uncharacterised protein family (UPF0172)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358474

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298492	0.999	BRISC complex subunit Abraxas 2
2	9606.ENSP00000343412	0.999	BRISC and BRCA1-A complex member 2
3	9606.ENSP00000352408	0.999	BRISC and BRCA1-A complex member 1
4	9606.ENSP00000366434	0.999	BRCA1-A complex subunit RAP80
5	9606.ENSP00000369857	0.999	BRCA1-A complex subunit Abraxas 1
6	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
7	9606.ENSP00000333667	0.998	Serine hydroxymethyltransferase, mitochondrial
8	9606.ENSP00000260947	0.991	BRCA1-associated RING domain protein 1
9	9606.ENSP00000441543	0.968	Polyubiquitin-C
10	9606.ENSP00000272317	0.942	Ubiquitin-40S ribosomal protein S27a
11	9606.ENSP00000328551	0.942	Ras-related protein Rab-28
12	9606.ENSP00000388107	0.940	Ubiquitin-60S ribosomal protein L40
13	9606.ENSP00000304697	0.933	Polyubiquitin-B
14	9606.ENSP00000426503	0.933	E3 ubiquitin-protein ligase RNF4
15	9606.ENSP00000356480	0.930	E3 ubiquitin-protein ligase RING2
16	9606.ENSP00000365588	0.928	Mediator of DNA damage checkpoint protein 1
17	9606.ENSP00000264552	0.927	Ubiquitin-conjugating enzyme E2 S
18	9606.ENSP00000337383	0.927	NACHT, LRR and PYD domains-containing protein 3
19	9606.ENSP00000349957	0.922	Anaphase promoting complex subunit 11
20	9606.ENSP00000348838	0.919	Ubiquitin-conjugating enzyme E2 C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140492	1.000	metal-dependent deubiquitinase activity
GO:0140030	0.996	modification-dependent protein binding
GO:0031593	0.968	polyubiquitin modification-dependent protein binding
GO:0061578	0.964	K63-linked deubiquitinase activity
GO:0098772	0.894	molecular function regulator activity
GO:0030234	0.880	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019538	0.985	protein metabolic process
GO:0036211	0.982	protein modification process
GO:0050794	0.979	regulation of cellular process
GO:0070647	0.974	protein modification by small protein conjugation or removal
GO:0006508	0.969	proteolysis
GO:0044237	0.942	cellular metabolic process
GO:0070646	0.935	protein modification by small protein removal
GO:0016579	0.929	protein deubiquitination
GO:0048518	0.913	positive regulation of biological process
GO:0019222	0.894	regulation of metabolic process
GO:0048522	0.883	positive regulation of cellular process
GO:0060255	0.857	regulation of macromolecule metabolic process
GO:0080090	0.850	regulation of primary metabolic process
GO:0051171	0.850	regulation of nitrogen compound metabolic process
GO:0006974	0.847	cellular response to DNA damage stimulus
GO:0048523	0.805	negative regulation of cellular process
GO:0006281	0.800	DNA repair
GO:0051726	0.795	regulation of cell cycle
GO:0010564	0.779	regulation of cell cycle process
GO:0000278	0.777	mitotic cell cycle
GO:0048583	0.759	regulation of response to stimulus
GO:0042770	0.736	signal transduction in response to DNA damage
GO:1903047	0.728	mitotic cell cycle process
GO:1901990	0.722	regulation of mitotic cell cycle phase transition
GO:0031323	0.710	regulation of cellular metabolic process
GO:0000077	0.709	DNA damage checkpoint signaling
GO:1902749	0.703	regulation of cell cycle G2/M phase transition
GO:0044773	0.697	mitotic DNA damage checkpoint signaling
GO:0010389	0.665	regulation of G2/M transition of mitotic cell cycle
GO:1901991	0.657	negative regulation of mitotic cell cycle phase transition
GO:0044818	0.649	mitotic G2/M transition checkpoint
GO:0080135	0.601	regulation of cellular response to stress
GO:0019219	0.592	regulation of nucleobase-containing compound metabolic process
GO:0007095	0.586	mitotic G2 DNA damage checkpoint signaling
GO:0009893	0.559	positive regulation of metabolic process
GO:0010604	0.535	positive regulation of macromolecule metabolic process
GO:0051173	0.454	positive regulation of nitrogen compound metabolic process
GO:0010212	0.413	response to ionizing radiation
GO:0051052	0.407	regulation of DNA metabolic process
GO:0031325	0.398	positive regulation of cellular metabolic process
GO:2001020	0.352	regulation of response to DNA damage stimulus
GO:0006282	0.327	regulation of DNA repair
GO:0006302	0.318	double-strand break repair
GO:0051054	0.317	positive regulation of DNA metabolic process
GO:0016570	0.316	histone modification
GO:2001022	0.313	positive regulation of response to DNA damage stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:1902494	0.997	catalytic complex
GO:0140535	0.995	intracellular protein-containing complex
GO:0140513	0.987	nuclear protein-containing complex
GO:1990234	0.973	transferase complex
GO:0000151	0.928	ubiquitin ligase complex
GO:0000152	0.799	nuclear ubiquitin ligase complex
GO:0070531	0.511	BRCA1-A complex
GO:0070552	0.479	BRISC complex
GO:0012505	0.431	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]