StarFunc result for job id P46821

User Input

>input (2468 residues)
MATVVVEATEPEPSGSIANPAASTSPSLSHRFLDSKFYLLVVVGEIVTEEHLRRAIGNIE
LGIRSWDTNLIECNLDQELKLFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAV
STEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHP
ANKASLTLFCPEEGDWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVEVP
SPFDILEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRH
LDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLN
VPENLKNPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKL
EMYVLNPVKSSKEMQYFMQQWTGTNKDKAEFILPNGQEVDLPISYLTSVSSLIVWHPANP
AEKIIRVLFPGNSTQYNILEGLEKLKHLDFLKQPLATQKDLTGQVPTPVVKQTKLKQRAD
SRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPIKTETKP
SVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEV
AKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEKKEPKKEVKKETPPKEVKKEVKKEEKKE
VKKEEKEPKKEIKKLPKDAKKSSTPLSEAKKPAALKPKVPKKEESVKKDSVAAGKPKEKG
KIKVIKKEGKAAEAVAAAVGTGATTAAVMAAAGIAAIGPAKELEAERSLMSSPEDLTKDF
EELKAEEVDVTKDIKPQLELIEDEEKLKETEPVEAYVIQKEREVTKGPAESPDEGITTTE
GEGECEQTPEELEPVEKQGVDDIEKFEDEGAGFEESSETGDYEEKAETEEAEEPEEDGEE
HVCVSASKHSPTEDEESAKAEADAYIREKRESVASGDDRAEEDMDEAIEKGEAEQSEEEA
DEEDKAEDAREEEYEPEKMEAEDYVMAVVDKAAEAGGAEEQYGFLTTPTKQLGAQSPGRE
PASSIHDETLPGGSESEATASDEENREDQPEEFTATSGYTQSTIEISSEPTPMDEMSTPR
DVMSDETNNEETESPSQEFVNITKYESSLYSQEYSKPADVTPLNGFSEGSKTDATDGKDY
NASASTISPPSSMEEDKFSRSALRDAYCSEVKASTTLDIKDSISAVSSEKVSPSKSPSLS
PSPPSPLEKTPLGERSVNFSLTPNEIKVSAEAEVAPVSPEVTQEVVEEHCASPEDKTLEV
VSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPM
DEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPD
QVSPVSEMTSTSLYQDKQEGKSTDFAPIKEDFGQEKKTDDVEAMSSQPALALDERKLGDV
SPTQIDVSQFGSFKEDTKMSISEGTVSDKSATPVDEGVAEDTYSHMEGVASVSTASVATS
SFPEPTTDDVSPSLHAEVGSPHSTEVDDSLSVSVVQTPTTFQETEMSPSKEECPRPMSIS
PPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEQSLAMDFSRQSPDHPTVGAGVLHIT
ENGPTEVDYSPSDMQDSSLSHKIPPMEEPSYTQDNDLSELISVSQVEASPSTSSAHTPSQ
IASPLQEDTLSDVAPPRDMSLYASLTSEKVQSLEGEKLSPKSDISPLTPRESSPLYSPTF
SDSTSAVKEKTATCHSSSSPPIDAASAEPYGFRASVLFDTMQHHLALNRDLSTPGLEKDS
GGKTPGDFSYAYQKPEETTRSPDEEDYDYESYEKTTRTSDVGGYYYEKIERTTKSPSDSG
YSYETIGKTTKTPEDGDYSYEIIEKTTRTPEEGGYSYDISEKTTSPPEVSGYSYEKTERS
RRLLDDISNGYDDSEDGGHTLGDPSYSYETTEKITSFPESEGYSYETSTKTTRTPDTSTY
CYETAEKITRTPQASTYSYETSDLCYTAEKKSPSEARQDVDLCLVSSCEYKHPKTELSPS
FINPNPLEWFASEEPTEESEKPLTQSGGAPPPPGGKQQGRQCDETPPTSVSESAPSQTDS
DVPPETEECPSITADANIDSEDESETIPTDKTVTYKHMDPPPAPVQDRSPSPRHPDVSMV
DPEALAIEQNLGKALKKDLKEKTKTKKPGTKTKSSSPVKKSDGKSKPLAASPKPAGLKES
SDKVSRVASPKKKESVEKAAKPTTTPEVKAARGEEKDKETKNAANASASKSAKTATAGPG
TTKTTKSSAVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRVRSSYYVVSGNDPAAEEPSRA
VLDALLEGKAQWGSNMQVTLIPTHDSEVMREWYQETHEKQQDLNIMVLASSSTVVMQDES
FPACKIEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2ZZ14	0.285	0.340	0.000	2033	0.487	0.591	B2ZZ14.pdb.gz	B2ZZ14_DANRE Hypothetical microtubule-associated protein 1b OS=Danio rerio OX=7955 GN=map1b PE=2 SV=1
2	AFDB:P46821	1.000	1.000	0.000	2468	1.000	1.000	P46821.pdb.gz	MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2
3	PDB:5lztjj	0.044	0.157	7.147E-5	428	0.015	0.084	5lztjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
4	PDB:7a5gZ	0.043	0.171	1.735E-4	394	0.011	0.066	7a5gZ.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
5	PDB:1z6xA	0.046	0.337	2.558E-4	175	0.010	0.137	1z6xA.pdb.gz	Structure Of Human ADP-Ribosylation Factor 4
6	PDB:4nblA	0.041	0.294	3.986E-4	258	0.009	0.085	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
7	PDB:7rllB	0.049	0.421	3.986E-4	177	0.011	0.153	7rllB.pdb.gz	Crystal structure of ARF3 from Candida albicans in complex with guanosine-3'-monophosphate-5'-diphosphate
8	PDB:2k5uA	0.046	0.371	4.975E-4	180	0.010	0.139	2k5uA.pdb.gz	Structure and Membrane Interaction of Myristoylated ARF1
9	PDB:3aq4A	0.044	0.352	7.334E-4	170	0.009	0.124	3aq4A.pdb.gz	Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
10	PDB:6ji2A	0.046	0.173	1.081E-3	432	0.015	0.088	6ji2A.pdb.gz	Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.
11	PDB:1ob2A	0.045	0.173	1.277E-3	393	0.014	0.087	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU
12	PDB:4ileA	0.046	0.324	1.350E-3	176	0.010	0.136	4ileA.pdb.gz	Structure of human ADP-ribosylation factor-like 8A binding to GDP
13	AFDB:Q14676	0.028	0.030	1.141E-1	2089	0.138	0.163	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
14	AFDB:Q60974	0.030	0.030	1.171	2453	0.122	0.122	Q60974.pdb.gz	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1
15	AFDB:Q9VUQ9	0.029	0.031	4.430	2139	0.104	0.120	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
16	AFDB:Q5H9R4	0.027	0.028	5.846	2290	0.121	0.130	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
17	AFDB:Q581A7	0.025	0.041	6.531	1205	0.079	0.163	Q581A7.pdb.gz	Q581A7_TRYB2 Srp40 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.380 PE=4 SV=1
18	AFDB:Q9Y2F5	0.023	0.024	6.531	2266	0.108	0.118	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
19	AFDB:Q8NFD5	0.023	0.025	6.903	2236	0.090	0.100	Q8NFD5.pdb.gz	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
20	AFDB:Q9JIH7	0.023	0.025	6.903	2126	0.102	0.118	Q9JIH7.pdb.gz	WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2ZZ14	0.0	1073	2033	0.240	0.292	B2ZZ14_DANRE Hypothetical microtubule-associated protein 1b OS=Danio rerio OX=7955 GN=map1b PE=2 SV=1
2	P14873	0.0	4100	2464	0.906	0.908	MAP1B_MOUSE Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2
3	P15205	0.0	2856	2461	0.620	0.622	MAP1B_RAT Microtubule-associated protein 1B OS=Rattus norvegicus OX=10116 GN=Map1b PE=1 SV=3
4	P46821	0.0	4971	2468	1.000	1.000	MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2
5	P78559	1.01e-153	537	2803	0.103	0.090	MAP1A_HUMAN Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6
6	Q9QYR6	1.21e-151	530	2776	0.100	0.089	MAP1A_MOUSE Microtubule-associated protein 1A OS=Mus musculus OX=10090 GN=Map1a PE=1 SV=2
7	P34926	1.47e-151	530	2774	0.094	0.084	MAP1A_RAT Microtubule-associated protein 1A OS=Rattus norvegicus OX=10116 GN=Map1a PE=1 SV=1
8	Q66K74	1.54e-143	479	1059	0.108	0.251	MAP1S_HUMAN Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S PE=1 SV=2
9	A8K940	7.86e-143	478	1059	0.107	0.250	A8K940_HUMAN cDNA FLJ77630, highly similar to Homo sapiens BPY2 interacting protein 1, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
10	P0C5W1	8.28e-123	416	972	0.094	0.239	MAP1S_RAT Microtubule-associated protein 1S OS=Rattus norvegicus OX=10116 GN=Map1s PE=1 SV=1
11	Q8C052	1.46e-122	416	973	0.095	0.240	MAP1S_MOUSE Microtubule-associated protein 1S OS=Mus musculus OX=10090 GN=Map1s PE=1 SV=2
12	Q9W596	8.52e-91	334	5495	0.065	0.029	FUTSC_DROME Microtubule-associated protein futsch OS=Drosophila melanogaster OX=7227 GN=futsch PE=1 SV=4
13	P91859	3.07e-09	65.1	878	0.028	0.080	MAP11_CAEEL Microtubule-associated protein homolog maph-1.1 OS=Caenorhabditis elegans OX=6239 GN=maph-1.1 PE=1 SV=1
14	F4IIV5	1.1	37.0	1297	0.020	0.039	F4IIV5_ARATH Maternal effect embryo arrest 22 OS=Arabidopsis thaliana OX=3702 GN=MEE22 PE=1 SV=1
15	O01761	6.0	34.7	8081	0.028	0.009	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
16	Q9QYX7	6.6	34.7	5068	0.030	0.014	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4
17	Q9NQ66	8.6	34.3	1216	0.013	0.025	PLCB1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens OX=9606 GN=PLCB1 PE=1 SV=1
18	Q4GZE3	9.3	33.9	1215	0.026	0.053	Q4GZE3_TRYB2 Metal-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.750 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00414 MAP1B_neuraxin	1.7e-35	130.2	Neuraxin and MAP1B repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296755

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380378	0.974	Platelet-activating factor acetylhydrolase IB subunit alpha
2	9606.ENSP00000476795	0.951	Gigaxonin
3	9606.ENSP00000392423	0.942	Reelin
4	9606.ENSP00000173229	0.938	Netrin-1
5	9606.ENSP00000348965	0.928	Cytoplasmic dynein 1 heavy chain 1
6	9606.ENSP00000360280	0.921	Disabled homolog 1
7	9606.ENSP00000371532	0.920	Very low-density lipoprotein receptor
8	9606.ENSP00000417864	0.920	Acidic leucine-rich nuclear phosphoprotein 32 family member A
9	9606.ENSP00000303634	0.917	Low-density lipoprotein receptor-related protein 8
10	9606.ENSP00000217244	0.914	Casein kinase II subunit alpha
11	9606.ENSP00000389140	0.910	Netrin receptor DCC
12	9606.ENSP00000452037	0.909	Dynein light chain 1, axonemal
13	9606.ENSP00000417963	0.904	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
14	9606.ENSP00000286827	0.903	T-lymphoma invasion and metastasis-inducing protein 1
15	9606.ENSP00000363970	0.885	Microtubule-associated proteins 1A/1B light chain 3A
16	9606.ENSP00000359506	0.879	Synaptic functional regulator FMR1
17	9606.ENSP00000315152	0.842	Methionine aminopeptidase 1D, mitochondrial
18	9606.ENSP00000269305	0.836	Cellular tumor antigen p53
19	9606.ENSP00000349547	0.835	Ras association domain-containing protein 1
20	9606.ENSP00000353508	0.832	Microtubule-associated protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0030030	0.966	cell projection organization
GO:0048699	0.966	generation of neurons
GO:0050789	0.947	regulation of biological process
GO:0050794	0.944	regulation of cellular process
GO:0048468	0.925	cell development
GO:0120036	0.924	plasma membrane bounded cell projection organization
GO:0030182	0.922	neuron differentiation
GO:0048666	0.913	neuron development
GO:0006996	0.804	organelle organization
GO:0061564	0.797	axon development
GO:1990138	0.743	neuron projection extension
GO:0051179	0.712	localization
GO:0007409	0.706	axonogenesis
GO:0007017	0.699	microtubule-based process
GO:0048519	0.607	negative regulation of biological process
GO:0050896	0.591	response to stimulus
GO:0048675	0.549	axon extension
GO:0048518	0.510	positive regulation of biological process
GO:0051716	0.465	cellular response to stimulus
GO:0048522	0.460	positive regulation of cellular process
GO:0048523	0.450	negative regulation of cellular process
GO:0007010	0.416	cytoskeleton organization
GO:0051234	0.414	establishment of localization
GO:0051641	0.383	cellular localization
GO:0006810	0.376	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005875	1.000	microtubule associated complex
GO:0043227	0.996	membrane-bounded organelle
GO:0005886	0.995	plasma membrane
GO:0030054	0.990	cell junction
GO:0042995	0.988	cell projection
GO:0120025	0.963	plasma membrane bounded cell projection
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0043005	0.833	neuron projection
GO:0045202	0.790	synapse
GO:0099572	0.734	postsynaptic specialization
GO:0098984	0.726	neuron to neuron synapse
GO:0036477	0.721	somatodendritic compartment
GO:0032279	0.720	asymmetric synapse
GO:0044297	0.719	cell body
GO:0005634	0.703	nucleus
GO:0014069	0.674	postsynaptic density
GO:0043025	0.419	neuronal cell body
GO:0030425	0.395	dendrite
GO:0043233	0.327	organelle lumen
GO:0070013	0.324	intracellular organelle lumen
GO:0099513	0.320	polymeric cytoskeletal fiber
GO:0031981	0.314	nuclear lumen
GO:0012505	0.312	endomembrane system
GO:0005929	0.311	cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]