StarFunc result for job id P46926

User Input

>input (289 residues)
MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGD
LSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDA
FEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTK
VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCD
EDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKETEKSQSSKKPYSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4FV08	0.967	0.967	1.444E-56	289	0.979	0.979	A4FV08.pdb.gz	GNPI1_BOVIN Glucosamine-6-phosphate isomerase 1 OS=Bos taurus OX=9913 GN=GNPDA1 PE=1 SV=1
2	PDB:1ne7A	0.931	0.957	6.481E-53	281	0.945	0.972	1ne7A.pdb.gz	Two mammalian glucosamine-6-phosphate deaminases: a structural and genetic study.
3	AFDB:Q8TDQ7	0.937	0.981	8.864E-53	276	0.834	0.873	Q8TDQ7.pdb.gz	GNPI2_HUMAN Glucosamine-6-phosphate isomerase 2 OS=Homo sapiens OX=9606 GN=GNPDA2 PE=1 SV=1
4	AFDB:O30564	0.899	0.969	6.113E-43	268	0.554	0.597	O30564.pdb.gz	NAGB_BORBU Glucosamine-6-phosphate deaminase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=nagB PE=1 SV=1
5	PDB:3hn6A	0.900	0.959	3.085E-42	271	0.557	0.594	3hn6A.pdb.gz	Crystal Structure of Glucosamine-6-phosphate deaminase from Borrelia burgdorferi
6	AFDB:P0A759	0.903	0.981	1.076E-41	266	0.536	0.583	P0A759.pdb.gz	NAGB_ECOLI Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain K12) OX=83333 GN=nagB PE=1 SV=1
7	PDB:1deaA	0.899	0.976	5.123E-41	266	0.536	0.583	1deaA.pdb.gz	Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from Escherichia coli at 2.1 A resolution.
8	AFDB:Q381A9	0.906	0.935	1.234E-39	280	0.509	0.525	Q381A9.pdb.gz	Q381A9_TRYB2 Glucosamine-6-phosphate isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8520 PE=3 SV=1
9	AFDB:Q54M58	0.814	0.329	1.931E-26	724	0.280	0.112	Q54M58.pdb.gz	Q54M58_DICDI Glucosamine-6-phosphate isomerase OS=Dictyostelium discoideum OX=44689 GN=nagB1 PE=3 SV=1
10	AFDB:Q8DV70	0.775	0.958	8.342E-26	233	0.280	0.348	Q8DV70.pdb.gz	NAGB_STRMU Glucosamine-6-phosphate deaminase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=nagB PE=1 SV=1
11	PDB:2ri1A	0.754	0.921	1.184E-23	235	0.280	0.345	2ri1A.pdb.gz	Ring-opening mechanism revealed by crystal structures of NagB and its ES intermediate complex
12	AFDB:D4A7D7	0.698	0.264	1.358E-14	797	0.159	0.058	D4A7D7.pdb.gz	D4A7D7_RAT Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) OS=Rattus norvegicus OX=10116 GN=H6pd PE=4 SV=1
13	PDB:3e7fB	0.645	0.704	2.685E-14	263	0.170	0.186	3e7fB.pdb.gz	Insights into the enzymatic mechanism of 6-phosphogluconolactonase from Trypanosoma brucei using structural data and molecular dynamics simulation.
14	PDB:3icoC	0.674	0.778	2.847E-14	247	0.215	0.251	3icoC.pdb.gz
15	AFDB:P9WQP5	0.671	0.775	9.370E-14	247	0.197	0.231	P9WQP5.pdb.gz	6PGL_MYCTU 6-phosphogluconolactonase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pgl PE=1 SV=1
16	AFDB:O95479	0.672	0.258	1.683E-13	791	0.159	0.058	O95479.pdb.gz	G6PE_HUMAN GDH/6PGL endoplasmic bifunctional protein OS=Homo sapiens OX=9606 GN=H6PD PE=1 SV=2
17	PDB:4l5jA	0.416	0.396	7.402E-6	308	0.093	0.088	4l5jA.pdb.gz	Crystal Structures of the LsrR Proteins Complexed with Phospho-AI-2 and Two Signal-Interrupting Analogues Reveal Distinct Mechanisms for Ligand Recognition.
18	PDB:7nvnT	0.269	0.257	6.208E-3	307	0.097	0.091	7nvnT.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
19	PDB:3s8mA	0.235	0.191	6.980E-3	390	0.104	0.077	3s8mA.pdb.gz
20	PDB:1lk7A	0.259	0.313	9.917E-3	229	0.100	0.127	1lk7A.pdb.gz	A Hyperthermostable D-Ribose-5-Phosphate Isomerase from Pyrococcus horikoshii Characterization and Three-Dimensional Structure

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4FV08	0.0	595	289	0.979	0.979	GNPI1_BOVIN Glucosamine-6-phosphate isomerase 1 OS=Bos taurus OX=9913 GN=GNPDA1 PE=1 SV=1
2	O88958	0.0	589	289	0.962	0.962	GNPI1_MOUSE Glucosamine-6-phosphate isomerase 1 OS=Mus musculus OX=10090 GN=Gnpda1 PE=1 SV=3
3	P46926	0.0	605	289	1.000	1.000	GNPI1_HUMAN Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens OX=9606 GN=GNPDA1 PE=1 SV=1
4	Q8TDQ7	0.0	516	276	0.834	0.873	GNPI2_HUMAN Glucosamine-6-phosphate isomerase 2 OS=Homo sapiens OX=9606 GN=GNPDA2 PE=1 SV=1
5	P0A759	2.12e-115	334	266	0.533	0.579	NAGB_ECOLI Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain K12) OX=83333 GN=nagB PE=1 SV=1
6	O30564	9.90e-113	328	268	0.550	0.593	NAGB_BORBU Glucosamine-6-phosphate deaminase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=nagB PE=1 SV=1
7	Q381A9	2.98e-106	312	280	0.495	0.511	Q381A9_TRYB2 Glucosamine-6-phosphate isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8520 PE=3 SV=1
8	Q8DV70	2.06e-36	132	233	0.287	0.356	NAGB_STRMU Glucosamine-6-phosphate deaminase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=nagB PE=1 SV=1
9	Q54M58	2.02e-33	131	724	0.277	0.110	Q54M58_DICDI Glucosamine-6-phosphate isomerase OS=Dictyostelium discoideum OX=44689 GN=nagB1 PE=3 SV=1
10	Q84WW2	3.44e-06	50.1	325	0.142	0.126	6PGL3_ARATH 6-phosphogluconolactonase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGL3 PE=1 SV=1
11	P9WQP5	1.58e-04	44.7	247	0.190	0.223	6PGL_MYCTU 6-phosphogluconolactonase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pgl PE=1 SV=1
12	P85971	6.24e-04	42.7	257	0.208	0.233	6PGL_RAT 6-phosphogluconolactonase OS=Rattus norvegicus OX=10116 GN=Pgls PE=1 SV=1
13	Q385D6	8.05e-04	42.4	266	0.187	0.203	Q385D6_TRYB2 6-phosphogluconolactonase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4200 PE=3 SV=1
14	Q9GRG6	8.90e-04	42.4	266	0.190	0.207	Q9GRG6_9TRYP 6-phosphogluconolactonase OS=Trypanosoma brucei OX=5691 GN=6pgl PE=1 SV=1
15	O74455	0.003	40.4	257	0.201	0.226	6PGL_SCHPO Probable 6-phosphogluconolactonase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC16C4.10 PE=3 SV=1
16	O95336	0.004	40.4	258	0.183	0.205	6PGL_HUMAN 6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2
17	Q9FIN1	0.015	38.5	261	0.145	0.161	6PGL4_ARATH Probable 6-phosphogluconolactonase 4 OS=Arabidopsis thaliana OX=3702 GN=PGL4 PE=2 SV=1
18	Q8LG70	0.17	35.4	259	0.128	0.143	6PGL2_ARATH Probable 6-phosphogluconolactonase 2 OS=Arabidopsis thaliana OX=3702 GN=PGL2 PE=2 SV=2
19	O18229	0.41	34.3	269	0.128	0.138	6PGL_CAEEL Putative 6-phosphogluconolactonase OS=Caenorhabditis elegans OX=6239 GN=Y57G11C.3 PE=3 SV=2
20	Q8LEV7	1.3	32.7	252	0.156	0.179	6PGL5_ARATH Probable 6-phosphogluconolactonase 5 OS=Arabidopsis thaliana OX=3702 GN=PGL5 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01182 Glucosamine_iso	6e-15	67.3	Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000423674

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391596	0.996	N-acetylglucosamine-6-phosphate deacetylase
2	9606.ENSP00000216410	0.970	Glucosamine-phosphate N-acetyltransferase 1
3	9606.ENSP00000455561	0.958	Uncharacterized protein
4	9606.ENSP00000402103	0.951	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
5	9606.ENSP00000405573	0.948	Glucose-6-phosphate isomerase
6	9606.ENSP00000318318	0.944	Mannose-6-phosphate isomerase
7	9606.ENSP00000253778	0.943	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
8	9606.ENSP00000349860	0.942	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
9	9606.ENSP00000295448	0.927	Glucosamine-6-phosphate deaminase 2
10	9606.ENSP00000290573	0.923	Hexokinase-2
11	9606.ENSP00000292432	0.923	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
12	9606.ENSP00000346643	0.923	Putative hexokinase HKDC1
13	9606.ENSP00000252603	0.907	6-phosphogluconolactonase
14	9606.ENSP00000473348	0.850	GDH/6PGL endoplasmic bifunctional protein
15	9606.ENSP00000377192	0.807	Glucose-6-phosphate 1-dehydrogenase
16	9606.ENSP00000477639	0.703	N-acetyl-D-glucosamine kinase
17	9606.ENSP00000457353	0.699	Probable crossover junction endonuclease EME2
18	9606.ENSP00000293404	0.698	N-acetylglutamate synthase, mitochondrial
19	9606.ENSP00000369614	0.694	Centrobin
20	9606.ENSP00000483375	0.571	UDP-glucose 4-epimerase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004342	1.000	glucosamine-6-phosphate deaminase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044281	0.989	small molecule metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0044238	0.985	primary metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:1901135	0.970	carbohydrate derivative metabolic process
GO:0034641	0.930	cellular nitrogen compound metabolic process
GO:1901360	0.911	organic cyclic compound metabolic process
GO:0046483	0.911	heterocycle metabolic process
GO:0006725	0.910	cellular aromatic compound metabolic process
GO:0055086	0.897	nucleobase-containing small molecule metabolic process
GO:1901137	0.892	carbohydrate derivative biosynthetic process
GO:0009566	0.888	fertilization
GO:0006040	0.871	amino sugar metabolic process
GO:0044249	0.854	cellular biosynthetic process
GO:0044271	0.839	cellular nitrogen compound biosynthetic process
GO:0006793	0.771	phosphorus metabolic process
GO:1901362	0.745	organic cyclic compound biosynthetic process
GO:0007338	0.670	single fertilization
GO:0034654	0.667	nucleobase-containing compound biosynthetic process
GO:0009225	0.547	nucleotide-sugar metabolic process
GO:0009226	0.531	nucleotide-sugar biosynthetic process
GO:0006091	0.412	generation of precursor metabolites and energy
GO:0046349	0.383	amino sugar biosynthetic process
GO:1901575	0.342	organic substance catabolic process
GO:1901564	0.308	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.992	cytosol
GO:0043227	0.964	membrane-bounded organelle
GO:0043231	0.911	intracellular membrane-bounded organelle
GO:0005634	0.469	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12172	1.000	alpha-D-glucosamine 6-phosphate + H2O = beta-D-fructose 6-phosphate + NH4(+)
EC:3.5.99.6	1.000	glucosamine-6-phosphate deaminase.

[back to server]