StarFunc result for job id P46934

User Input

>input (1319 residues)
MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHMCFKRPTRISTSNVVQMKLTPRQTALAP
LIKENVQSQERSSVPSSENVNKKSSCLQISLQPTRYSGYLQSSNVLADSDDASFTCILKD
GIYSSAVVDNELNAVNDGHLVSSPAICSGSLSNFSTSDNGSYSSNGSDFGSCASITSGGS
YTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDD
LEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFI
ISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNT
PRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIKLMHRTS
ACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLGGAYPNISCLSSLKHNCSKGG
PSQLLIKFASGNEGKVDNLSRDSNRDCTNELSNSCKTRDDFLGQVDVPLYPLPTENPRLE
RPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAA
CHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQ
RAFTTRRQISEETESVDNRESSENWEIIREDEATMYSNQAFPSPPPSSNLDVPTHLAEEL
NARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDER
GRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQG
FLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEE
RTHTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPN
KFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMF
NPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFY
KMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSE
IVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLG
DVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAEL
YGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46934	1.000	1.000	0.000	1319	1.000	1.000	P46934.pdb.gz	NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4 PE=1 SV=4
2	PDB:7jq9A	0.206	0.119	5.540E-35	2427	0.133	0.072	7jq9A.pdb.gz
3	PDB:7mopA	0.199	0.116	7.936E-34	2445	0.130	0.070	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
4	AFDB:Q09XV5	0.033	0.022	3.688E-2	2582	0.084	0.043	Q09XV5.pdb.gz	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
5	AFDB:Q4LDP4	0.041	0.033	4.102E-2	1931	0.127	0.087	Q4LDP4.pdb.gz	Q4LDP4_DROME Testis-specific gamma-tubulin ring protein 91 OS=Drosophila melanogaster OX=7227 GN=t-Grip91 PE=4 SV=1
6	AFDB:S4R1W5	0.035	0.040	5.955E-2	1118	0.090	0.106	S4R1W5.pdb.gz	S4R1W5_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
7	AFDB:Q9C0I3	0.044	0.060	6.281E-2	900	0.111	0.163	Q9C0I3.pdb.gz	CCSE1_HUMAN Serine-rich coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CCSER1 PE=1 SV=2
8	PDB:1nmvA	0.025	0.179	7.948E-2	163	0.013	0.104	1nmvA.pdb.gz
9	AFDB:Q3TRU3	0.039	0.049	1.128E-1	997	0.087	0.115	Q3TRU3.pdb.gz	Q3TRU3_MOUSE MutL C-terminal dimerisation domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Mlh3 PE=2 SV=1
10	PDB:7kkfA	0.025	0.187	1.283E-1	162	0.011	0.086	7kkfA.pdb.gz
11	AFDB:A2A891	0.032	0.028	1.638E-1	1682	0.111	0.087	A2A891.pdb.gz	CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus OX=10090 GN=Camta1 PE=2 SV=1
12	AFDB:A1Z9W4	0.032	0.025	2.026E-1	1953	0.100	0.068	A1Z9W4.pdb.gz	A1Z9W4_DROME LD11480p OS=Drosophila melanogaster OX=7227 GN=Pcf11 PE=1 SV=2
13	PDB:1yw5A	0.025	0.175	2.564E-1	177	0.010	0.073	1yw5A.pdb.gz
14	AFDB:Q8IHQ2	0.031	0.032	2.644E-1	1301	0.081	0.082	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
15	AFDB:E7F226	0.035	0.033	3.102E-1	1531	0.083	0.071	E7F226.pdb.gz
16	PDB:3o3mC	0.034	0.070	4.857E-1	401	0.016	0.052	3o3mC.pdb.gz	Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
17	PDB:3vnlA	0.038	0.120	7.436E-1	291	0.019	0.086	3vnlA.pdb.gz	Crystal structures of D-psicose 3-epimerase from Clostridium cellulolyticum H10 and its complex with ketohexose sugars.
18	PDB:7ou2A	0.032	0.051	8.272E-1	721	0.020	0.037	7ou2A.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
19	PDB:5ee7A	0.040	0.083	1.024	416	0.020	0.065	5ee7A.pdb.gz	Extra-helical binding site of a glucagon receptor antagonist.
20	PDB:2nyxB	0.031	0.159	1.486	147	0.011	0.095	2nyxB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUY1	910	921	0.373	0.534	A0A0G2JUY1_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=2
2	A0A8I6A4L5	1078	976	0.420	0.568	A0A8I6A4L5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
3	A0A8I6A6J7	909	921	0.373	0.534	A0A8I6A6J7_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
4	A0A8I6AEH7	803	1071	0.281	0.345	A0A8I6AEH7_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
5	A0A8I6AIV5	1030	872	0.405	0.612	A0A8I6AIV5_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
6	A0A8I6GKS9	910	942	0.373	0.522	A0A8I6GKS9_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
7	A0A8I6GL04	1037	912	0.410	0.593	A0A8I6GL04_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
8	A0A8I6GLU0	1085	956	0.422	0.582	A0A8I6GLU0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
9	D7NIW0	1079	968	0.420	0.572	D7NIW0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
10	F1LRN8	902	856	0.371	0.571	F1LRN8_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=4
11	H0VCR8	1021	984	0.408	0.547	H0VCR8_CAVPO HECT-type E3 ubiquitin transferase OS=Cavia porcellus OX=10141 GN=NEDD4L PE=4 SV=2
12	P39940	561	809	0.219	0.357	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
13	P46934	2752	1319	1.000	1.000	NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens OX=9606 GN=NEDD4 PE=1 SV=4
14	P46935	1264	887	0.484	0.719	NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus OX=10090 GN=Nedd4 PE=1 SV=3
15	Q3KRP0	1092	910	0.419	0.608	Q3KRP0_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=si:ch211-79l17.5 PE=2 SV=1
16	Q5BDP1	557	821	0.218	0.350	RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hulA PE=1 SV=1
17	Q5U1Z5	773	440	0.274	0.823	Q5U1Z5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
18	Q62940	1273	887	0.480	0.714	NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus OX=10116 GN=Nedd4 PE=1 SV=1
19	Q8CFI0	1080	1004	0.420	0.552	NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus OX=10090 GN=Nedd4l PE=1 SV=2
20	Q92462	572	767	0.215	0.370	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00632 HECT	7.5e-95	329.5	HECT-domain (ubiquitin-transferase)
2	PF00397 WW	9.8e-42	152.0	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265138	0.999	Arrestin domain-containing protein 3
2	9606.ENSP00000361021	0.999	Phosphatase and tensin homolog
3	9606.ENSP00000381793	0.999	Growth factor receptor-bound protein 10
4	9606.ENSP00000282561	0.997	Gap junction alpha-1 protein
5	9606.ENSP00000441543	0.994	Polyubiquitin-C
6	9606.ENSP00000272317	0.993	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000345826	0.993	Protein TMEPAI
8	9606.ENSP00000345751	0.989	Amiloride-sensitive sodium channel subunit beta
9	9606.ENSP00000368699	0.988	Ubiquitin-like protein ISG15
10	9606.ENSP00000353292	0.987	Amiloride-sensitive sodium channel subunit alpha
11	9606.ENSP00000253814	0.986	NEDD4 family-interacting protein 1
12	9606.ENSP00000300061	0.983	Amiloride-sensitive sodium channel subunit gamma
13	9606.ENSP00000342235	0.975	Receptor tyrosine-protein kinase erbB-4
14	9606.ENSP00000363019	0.972	Ubiquitin-conjugating enzyme E2 D1
15	9606.ENSP00000403701	0.972	Beta-arrestin-2
16	9606.ENSP00000480798	0.972	NEDD4 family-interacting protein 2
17	9606.ENSP00000381717	0.968	Ubiquitin-conjugating enzyme E2 D2
18	9606.ENSP00000400906	0.967	Ubiquitin-conjugating enzyme E2L 3
19	9606.ENSP00000251968	0.966	Tumor susceptibility gene 101 protein
20	9606.ENSP00000305372	0.964	Beta-2 adrenergic receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0019899	0.990	enzyme binding
GO:0061659	0.985	ubiquitin-like protein ligase activity
GO:0061630	0.983	ubiquitin protein ligase activity
GO:0098772	0.828	molecular function regulator activity
GO:0005102	0.798	signaling receptor binding
GO:0008200	0.755	ion channel inhibitor activity
GO:0017080	0.714	sodium channel regulator activity
GO:0070064	0.707	proline-rich region binding
GO:0019904	0.581	protein domain specific binding
GO:0019871	0.548	sodium channel inhibitor activity
GO:0043130	0.537	ubiquitin binding
GO:0031690	0.530	adrenergic receptor binding
GO:0031698	0.523	beta-2 adrenergic receptor binding
GO:0070063	0.513	RNA polymerase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0019538	0.975	protein metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0080090	0.953	regulation of primary metabolic process
GO:0051171	0.952	regulation of nitrogen compound metabolic process
GO:0036211	0.929	protein modification process
GO:0048523	0.921	negative regulation of cellular process
GO:0050896	0.891	response to stimulus
GO:0009893	0.888	positive regulation of metabolic process
GO:0051246	0.886	regulation of protein metabolic process
GO:0010604	0.881	positive regulation of macromolecule metabolic process
GO:0051173	0.878	positive regulation of nitrogen compound metabolic process
GO:0051716	0.823	cellular response to stimulus
GO:0070647	0.816	protein modification by small protein conjugation or removal
GO:0048522	0.815	positive regulation of cellular process
GO:0051247	0.812	positive regulation of protein metabolic process
GO:0044237	0.803	cellular metabolic process
GO:0048583	0.783	regulation of response to stimulus
GO:0023051	0.727	regulation of signaling
GO:0031323	0.697	regulation of cellular metabolic process
GO:0009966	0.690	regulation of signal transduction
GO:0007154	0.657	cell communication
GO:0051179	0.649	localization
GO:0010468	0.622	regulation of gene expression
GO:0023052	0.610	signaling
GO:0032446	0.607	protein modification by small protein conjugation
GO:0016567	0.548	protein ubiquitination
GO:0007165	0.538	signal transduction
GO:0065009	0.517	regulation of molecular function
GO:0009894	0.483	regulation of catabolic process
GO:0009056	0.472	catabolic process
GO:0051234	0.471	establishment of localization
GO:0006508	0.471	proteolysis
GO:0019219	0.447	regulation of nucleobase-containing compound metabolic process
GO:0006810	0.446	transport
GO:0042221	0.434	response to chemical
GO:0009892	0.425	negative regulation of metabolic process
GO:0009889	0.400	regulation of biosynthetic process
GO:0023056	0.388	positive regulation of signaling
GO:0044248	0.387	cellular catabolic process
GO:1901575	0.378	organic substance catabolic process
GO:0010647	0.374	positive regulation of cell communication
GO:0071840	0.372	cellular component organization or biogenesis
GO:0051172	0.364	negative regulation of nitrogen compound metabolic process
GO:0048584	0.362	positive regulation of response to stimulus
GO:1902531	0.359	regulation of intracellular signal transduction
GO:0016043	0.357	cellular component organization
GO:0006511	0.351	ubiquitin-dependent protein catabolic process
GO:0010605	0.337	negative regulation of macromolecule metabolic process
GO:0051252	0.332	regulation of RNA metabolic process
GO:0065008	0.330	regulation of biological quality
GO:0051641	0.327	cellular localization
GO:0010033	0.327	response to organic substance
GO:0010556	0.325	regulation of macromolecule biosynthetic process
GO:0006355	0.324	regulation of DNA-templated transcription
GO:0042176	0.321	regulation of protein catabolic process
GO:0006950	0.308	response to stress
GO:0009896	0.305	positive regulation of catabolic process
GO:0070887	0.301	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0005886	0.996	plasma membrane
GO:0005576	0.990	extracellular region
GO:0005634	0.989	nucleus
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0031982	0.976	vesicle
GO:0070062	0.972	extracellular exosome
GO:0032991	0.966	protein-containing complex
GO:0070013	0.937	intracellular organelle lumen
GO:0031981	0.727	nuclear lumen
GO:0005654	0.653	nucleoplasm
GO:0005794	0.618	Golgi apparatus
GO:0098590	0.442	plasma membrane region
GO:0005938	0.356	cell cortex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]