StarFunc result for job id P46937

User Input

>input (504 residues)
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGD
SETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTP
QHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMA
KTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS
NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGG
TQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSS
DILNDMESVLAATKLDKESFLTWL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46937	1.000	1.000	2.498E-83	504	1.000	1.000	P46937.pdb.gz	YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2
2	AFDB:A0A024R3E4	0.149	0.160	6.243E-60	454	0.891	0.989	A0A024R3E4.pdb.gz
3	AFDB:Q1L8J7	0.272	0.306	1.282E-54	442	0.716	0.817	Q1L8J7.pdb.gz	YAP1_DANRE Transcriptional coactivator YAP1 OS=Danio rerio OX=7955 GN=yap1 PE=2 SV=2
4	AFDB:F1NMZ1	0.121	0.063	4.177E-8	1256	0.107	0.043	F1NMZ1.pdb.gz
5	AFDB:Q6RHR9	0.124	0.056	4.073E-7	1471	0.183	0.063	Q6RHR9.pdb.gz	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
6	AFDB:H7C5T8	0.112	0.068	1.314E-6	1014	0.163	0.081	H7C5T8.pdb.gz	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
7	AFDB:Q9H0M0	0.074	0.044	1.557E-5	922	0.129	0.070	Q9H0M0.pdb.gz	WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1 PE=1 SV=1
8	AFDB:A0A0A0MRT2	0.067	0.068	2.797E-5	495	0.143	0.145	A0A0A0MRT2.pdb.gz	A0A0A0MRT2_HUMAN WW domain containing adaptor with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=1
9	PDB:1nmvA	0.062	0.180	5.621E-2	163	0.026	0.080	1nmvA.pdb.gz
10	AFDB:P52890	0.066	0.061	8.365E-2	566	0.157	0.140	P52890.pdb.gz	ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf1 PE=1 SV=1
11	AFDB:O00268	0.069	0.038	9.528E-2	1085	0.224	0.104	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
12	PDB:7kkfA	0.063	0.181	1.310E-1	162	0.022	0.068	7kkfA.pdb.gz
13	PDB:1yw5A	0.065	0.174	1.935E-1	177	0.024	0.068	1yw5A.pdb.gz
14	PDB:6drtA	0.060	0.107	2.204E-1	230	0.028	0.061	6drtA.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
15	PDB:4wjlB	0.052	0.039	1.051	719	0.018	0.013	4wjlB.pdb.gz
16	PDB:6y0fC	0.059	0.043	1.768	722	0.018	0.012	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
17	PDB:3jb9M	0.052	0.112	2.448	207	0.069	0.169	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
18	PDB:2ns2A	0.058	0.119	2.788	201	0.030	0.075	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
19	PDB:6fyxm	0.060	0.174	2.788	147	0.024	0.082	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
20	PDB:3k1lA	0.052	0.067	3.617	376	0.024	0.032	3k1lA.pdb.gz	The structure of the catalytic subunit FANCL of the Fanconi anemia core complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P46936	0.0	520	448	0.611	0.688	YAP1_CHICK Transcriptional coactivator YAP1 OS=Gallus gallus OX=9031 GN=YAP1 PE=1 SV=1
2	P46937	0.0	1017	504	1.000	1.000	YAP1_HUMAN Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2
3	P46938	0.0	840	488	0.833	0.861	YAP1_MOUSE Transcriptional coactivator YAP1 OS=Mus musculus OX=10090 GN=Yap1 PE=1 SV=2
4	Q1L8J7	0.0	686	442	0.714	0.814	YAP1_DANRE Transcriptional coactivator YAP1 OS=Danio rerio OX=7955 GN=yap1 PE=2 SV=2
5	Q2EJA0	0.0	785	469	0.796	0.855	YAP1_RAT Transcriptional coactivator YAP1 OS=Rattus norvegicus OX=10116 GN=Yap1 PE=1 SV=1
6	Q9GZV5	1.71e-97	302	400	0.415	0.522	WWTR1_HUMAN WW domain-containing transcription regulator protein 1 OS=Homo sapiens OX=9606 GN=WWTR1 PE=1 SV=1
7	Q4V7E6	9.37e-94	292	395	0.401	0.511	Q4V7E6_RAT WW domain containing transcription regulator 1 OS=Rattus norvegicus OX=10116 GN=Wwtr1 PE=4 SV=1
8	Q9EPK5	2.39e-93	291	395	0.401	0.511	WWTR1_MOUSE WW domain-containing transcription regulator protein 1 OS=Mus musculus OX=10090 GN=Wwtr1 PE=1 SV=2
9	Q307I6	4.86e-50	177	391	0.246	0.317	Q307I6_DANRE WW domain-containing transcription regulator 1 OS=Danio rerio OX=7955 GN=wwtr1 PE=2 SV=1
10	C9J038	1.39e-47	165	189	0.194	0.519	C9J038_HUMAN WW domain containing transcription regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=WWTR1 PE=1 SV=1
11	Q45VV3	5.01e-20	94.4	395	0.097	0.124	YAP1_DROME Transcriptional coactivator yorkie OS=Drosophila melanogaster OX=7227 GN=yki PE=1 SV=2
12	P39940	1.03e-16	85.9	809	0.079	0.049	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
13	O14326	4.16e-16	83.6	786	0.079	0.051	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
14	D7NIW0	2.35e-15	81.6	968	0.087	0.045	D7NIW0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
15	A0A8I6GL04	2.38e-15	81.6	912	0.087	0.048	A0A8I6GL04_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
16	A0A8I6AIV5	2.52e-15	81.3	872	0.087	0.050	A0A8I6AIV5_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
17	Q8CFI0	2.63e-15	81.3	1004	0.087	0.044	NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus OX=10090 GN=Nedd4l PE=1 SV=2
18	A0A8I6A4L5	2.73e-15	81.3	976	0.087	0.045	A0A8I6A4L5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
19	A0A8I6GLU0	2.73e-15	81.3	956	0.087	0.046	A0A8I6GLU0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
20	H0VCR8	3.18e-15	81.3	984	0.087	0.045	H0VCR8_CAVPO HECT-type E3 ubiquitin transferase OS=Cavia porcellus OX=10141 GN=NEDD4L PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15238 FAM181	0.17	23.3	FAM181
2	PF03621 MbtH	20	16.0	MbtH-like protein
3	PF00397 WW	2.8e-17	73.8	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000007247

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000007766	0.998	Transcriptional enhancer factor TEF-3
2	9598.ENSPTRP00000009705	0.998	LATS, large tumor suppressor, homolog 2
3	9598.ENSPTRP00000017016	0.998	Mothers against decapentaplegic homolog
4	9598.ENSPTRP00000031907	0.998	LATS, large tumor suppressor, homolog 1
5	9598.ENSPTRP00000060881	0.994	TEA domain family member 1 (SV40 transcriptional enhancer factor)
6	9598.ENSPTRP00000038209	0.993	Uncharacterized protein
7	9598.ENSPTRP00000028297	0.992	Mothers against decapentaplegic homolog
8	9598.ENSPTRP00000022026	0.974	Receptor protein-tyrosine kinase
9	9598.ENSPTRP00000003384	0.972	Tumor protein p53 binding protein 2
10	9598.ENSPTRP00000017009	0.972	Mothers against decapentaplegic homolog
11	9598.ENSPTRP00000019376	0.971	TEA domain family member 2
12	9598.ENSPTRP00000000118	0.970	Tumor protein p73
13	9598.ENSPTRP00000030895	0.960	TEA domain family member 3
14	9598.ENSPTRP00000044466	0.960	Catenin (Cadherin-associated protein), beta 1, 88kDa
15	9598.ENSPTRP00000012319	0.954	Mothers against decapentaplegic homolog
16	9598.ENSPTRP00000036200	0.942	Transforming growth factor, beta receptor 1
17	9598.ENSPTRP00000040709	0.942	Angiomotin like 2
18	9598.ENSPTRP00000017047	0.937	Mothers against decapentaplegic homolog
19	9598.ENSPTRP00000052121	0.937	Uncharacterized protein
20	9598.ENSPTRP00000038918	0.935	TGF-beta receptor type-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.989	heterocyclic compound binding
GO:0097159	0.989	organic cyclic compound binding
GO:0003676	0.984	nucleic acid binding
GO:0140110	0.967	transcription regulator activity
GO:0003677	0.966	DNA binding
GO:0008134	0.917	transcription factor binding
GO:0000976	0.915	transcription cis-regulatory region binding
GO:0003713	0.907	transcription coactivator activity
GO:0140297	0.878	DNA-binding transcription factor binding
GO:0098772	0.866	molecular function regulator activity
GO:0140678	0.738	molecular function inhibitor activity
GO:0003714	0.703	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0019222	0.992	regulation of metabolic process
GO:0048518	0.990	positive regulation of biological process
GO:0051716	0.988	cellular response to stimulus
GO:0007165	0.983	signal transduction
GO:0080090	0.977	regulation of primary metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0048522	0.977	positive regulation of cellular process
GO:0031323	0.976	regulation of cellular metabolic process
GO:0048519	0.974	negative regulation of biological process
GO:0009966	0.974	regulation of signal transduction
GO:0048731	0.962	system development
GO:0006950	0.961	response to stress
GO:0009893	0.954	positive regulation of metabolic process
GO:0010941	0.952	regulation of cell death
GO:0010468	0.949	regulation of gene expression
GO:0045595	0.931	regulation of cell differentiation
GO:0048523	0.929	negative regulation of cellular process
GO:0010604	0.918	positive regulation of macromolecule metabolic process
GO:0009892	0.911	negative regulation of metabolic process
GO:0051173	0.911	positive regulation of nitrogen compound metabolic process
GO:0009889	0.908	regulation of biosynthetic process
GO:0019219	0.908	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.904	positive regulation of cellular metabolic process
GO:0030154	0.902	cell differentiation
GO:0006355	0.902	regulation of DNA-templated transcription
GO:0042221	0.897	response to chemical
GO:0007166	0.889	cell surface receptor signaling pathway
GO:0010605	0.887	negative regulation of macromolecule metabolic process
GO:0035556	0.880	intracellular signal transduction
GO:0045935	0.879	positive regulation of nucleobase-containing compound metabolic process
GO:0008284	0.873	positive regulation of cell population proliferation
GO:0009891	0.866	positive regulation of biosynthetic process
GO:0045944	0.861	positive regulation of transcription by RNA polymerase II
GO:0071840	0.858	cellular component organization or biogenesis
GO:0016043	0.849	cellular component organization
GO:0009967	0.849	positive regulation of signal transduction
GO:0051239	0.838	regulation of multicellular organismal process
GO:0043067	0.777	regulation of programmed cell death
GO:0071495	0.769	cellular response to endogenous stimulus
GO:0009888	0.755	tissue development
GO:0048513	0.751	animal organ development
GO:0051093	0.748	negative regulation of developmental process
GO:0010033	0.741	response to organic substance
GO:0042981	0.725	regulation of apoptotic process
GO:0070887	0.670	cellular response to chemical stimulus
GO:0060429	0.633	epithelium development
GO:0030855	0.600	epithelial cell differentiation
GO:0071704	0.537	organic substance metabolic process
GO:0044238	0.516	primary metabolic process
GO:0060548	0.510	negative regulation of cell death
GO:0051094	0.508	positive regulation of developmental process
GO:0043069	0.497	negative regulation of programmed cell death
GO:0031324	0.493	negative regulation of cellular metabolic process
GO:0051172	0.492	negative regulation of nitrogen compound metabolic process
GO:0055123	0.490	digestive system development
GO:0048565	0.484	digestive tract development
GO:0006807	0.476	nitrogen compound metabolic process
GO:0009653	0.456	anatomical structure morphogenesis
GO:0043170	0.428	macromolecule metabolic process
GO:0044237	0.414	cellular metabolic process
GO:0048468	0.403	cell development
GO:0040008	0.393	regulation of growth
GO:0043066	0.389	negative regulation of apoptotic process
GO:1901564	0.373	organonitrogen compound metabolic process
GO:1901700	0.344	response to oxygen-containing compound
GO:0051128	0.342	regulation of cellular component organization
GO:0033993	0.332	response to lipid
GO:0065009	0.324	regulation of molecular function
GO:0019538	0.323	protein metabolic process
GO:0071310	0.301	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0032991	0.993	protein-containing complex
GO:0005829	0.990	cytosol
GO:0030054	0.919	cell junction
GO:0140513	0.746	nuclear protein-containing complex
GO:0005667	0.718	transcription regulator complex
GO:0043232	0.682	intracellular non-membrane-bounded organelle
GO:0090575	0.523	RNA polymerase II transcription regulator complex
GO:0140552	0.368	TEAD-YAP complex
GO:0016020	0.336	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]