StarFunc result for job id P46939

User Input

>input (1400 residues)
MAKYGEHEASPDNGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWT
DGLAFNAVLHRHKPDLFSWDKVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEEEAINIQSTAPEEEHESPRAET
PSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFATHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNARWEALRVESMDRQSRLHDVLM
ELQKKQLQQLSAWLTLTEERIQKMETCPLDDDVKSLQKLLEEHKSLQSDLEAEQVKVNSL
THMVVIVDENSGESATAILEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQL
LDNSKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVRVRE
QAITKKSKQELPPPPPPKKRQIHVDIEAKKKFDAISAELLNWILKWKTAIQTTEIKEYMK
MQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIKNVLEKVSSEW
KNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDS
CQRELTNLLGLHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGRYQAVQEAVEDRQQHL
ENELKGQPGHAYLETLKTLKDVLNDSENKAQVSLNVLNDLAKVEKALQEKKTLDEILENQ
KPALHKLAEETKALEKNVHPDVEKLYKQEFDDVQGKWNKLKVLVSKDLHLLEEIALTLRA
FEADSTVIEKWMDGVKDFLMKQQAAQGDDAGLQRQLDQCSAFVNEIETIESSLKNMKEIE
TNLRSGPVAGIKTWVQTRLGDYQTQLEKLSKEIATQKSRLSESQEKAANLKKDLAEMQEW
MTQAEEEYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGG
QELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEERMKSTE
VLPEKTDAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYED
LSHLAESKQISLEKQLQVLRETDQMLQVLQESLGELDKQLTTYLTDRIDAFQVPQEAQKI
QAEISAHELTLEELRRNMRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1W2P8A5	0.244	0.456	1.368E-73	732	0.461	0.881	A0A1W2P8A5.pdb.gz	A0A1W2P8A5_MOUSE Utrophin (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
2	AFDB:A0A0R4IF13	0.188	0.439	1.371E-45	583	0.230	0.552	A0A0R4IF13.pdb.gz
3	AFDB:O15020	0.163	0.096	9.700E-33	2390	0.195	0.114	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
4	AFDB:Q00963	0.180	0.124	2.874E-31	2291	0.217	0.133	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
5	AFDB:P11277	0.159	0.105	4.250E-31	2137	0.201	0.132	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
6	AFDB:F1QQE5	0.167	0.101	1.259E-30	2357	0.184	0.109	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
7	AFDB:Q01082	0.164	0.098	2.313E-30	2364	0.200	0.118	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
8	AFDB:E0AHA7	0.164	0.099	1.259E-29	2326	0.196	0.118	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
9	AFDB:Q9H254	0.218	0.139	4.843E-28	2564	0.211	0.115	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
10	AFDB:Q503P9	0.169	0.296	8.522E-24	786	0.137	0.244	Q503P9.pdb.gz
11	PDB:4d1eA	0.154	0.248	3.795E-17	859	0.117	0.191	4d1eA.pdb.gz
12	PDB:1sjjA	0.109	0.163	1.175E-12	863	0.116	0.189	1sjjA.pdb.gz
13	PDB:7sx8D	0.127	0.347	1.593E-5	448	0.040	0.125	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:8escZ	0.070	0.043	6.400E-3	3543	0.107	0.042	8escZ.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
15	PDB:7qpgR	0.060	0.047	6.981E-3	2208	0.141	0.090	7qpgR.pdb.gz
16	PDB:7t3uC	0.068	0.063	7.615E-3	1575	0.131	0.117	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:6bcuA	0.078	0.061	1.399E-2	2204	0.119	0.076	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
18	PDB:7t3pA	0.071	0.054	1.980E-2	2066	0.125	0.085	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:7mqaLM	0.064	0.050	2.570E-2	2041	0.103	0.071	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:1tr2B	0.060	0.073	4.145E-2	1029	0.084	0.115	1tr2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JW60	0.0	2315	3424	0.839	0.343	A0A0G2JW60_RAT Utrophin OS=Rattus norvegicus OX=10116 GN=Utrn PE=1 SV=1
2	A0A0R4IXX0	0.0	1143	3609	0.443	0.172	A0A0R4IXX0_DANRE Dystrophin OS=Danio rerio OX=7955 GN=Dp71 PE=1 SV=2
3	A0A1W2P8A5	0.0	1221	732	0.464	0.888	A0A1W2P8A5_MOUSE Utrophin (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
4	A0A1W2P8G5	0.0	1275	730	0.482	0.925	A0A1W2P8G5_MOUSE Utrophin (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
5	E9Q6R7	0.0	2315	3430	0.866	0.353	E9Q6R7_MOUSE Utrophin OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
6	G3V7L1	0.0	2363	3419	0.855	0.350	UTRN_RAT Utrophin OS=Rattus norvegicus OX=10116 GN=Utrn PE=1 SV=3
7	O08614	0.0	2278	3429	0.856	0.349	O08614_MOUSE Cytoskeletal protein OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
8	P11530	0.0	1234	3677	0.471	0.179	DMD_RAT Dystrophin OS=Rattus norvegicus OX=10116 GN=Dmd PE=1 SV=2
9	P11531	0.0	1237	3678	0.471	0.179	DMD_MOUSE Dystrophin OS=Mus musculus OX=10090 GN=Dmd PE=1 SV=3
10	P11532	0.0	1234	3685	0.472	0.179	DMD_HUMAN Dystrophin OS=Homo sapiens OX=9606 GN=DMD PE=1 SV=3
11	P46939	0.0	2827	3433	1.000	0.408	UTRN_HUMAN Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2
12	Q3TR59	0.0	1203	718	0.458	0.893	Q3TR59_MOUSE Calponin-homology (CH) domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
13	Q3UYS4	0.0	1268	727	0.479	0.923	Q3UYS4_MOUSE Calponin-homology (CH) domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
14	Q6P6L2	0.0	1275	732	0.483	0.923	Q6P6L2_MOUSE Utrn protein (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
15	Q810I5	0.0	1272	732	0.481	0.921	Q810I5_MOUSE Utrn protein (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
16	A0A1W2P6L4	6.42e-107	338	186	0.114	0.855	A0A1W2P6L4_MOUSE Utrophin (Fragment) OS=Mus musculus OX=10090 GN=Utrn PE=1 SV=1
17	Q9VDW6	5.94e-88	320	3598	0.151	0.059	DMDA_DROME Dystrophin, isoforms A/C/F/G/H OS=Drosophila melanogaster OX=7227 GN=Dys PE=1 SV=3
18	O77291	3.61e-63	240	2396	0.084	0.049	O77291_DROME Kakapo (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
19	G3V6S0	3.82e-63	240	2361	0.079	0.047	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
20	Q01082	3.83e-63	240	2364	0.079	0.047	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	0.72	21.0	CAMSAP CH domain
2	PF16907 Caskin-Pro-rich	3.8e+02	13.0	Proline rich region of Caskin proteins
3	PF00307 CH	7.7e-40	146.8	Calponin homology (CH) domain
4	PF17594 GP57	42	15.3	Phage Tail fiber assembly helper gene product 57
5	PF18041 MapZ_EC1	54	15.5	MapZ extracellular domain 1
6	PF00435 Spectrin	5.3e-63	221.4	Spectrin repeat
7	PF08913 VBS	4.4e+02	12.8	Vinculin Binding Site

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356515

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442600	0.999	Dystroglycan
2	9606.ENSP00000355645	0.989	Actin, alpha skeletal muscle
3	9606.ENSP00000338191	0.986	Beta-2-syntrophin
4	9606.ENSP00000298854	0.984	43 kDa receptor-associated protein of the synapse
5	9606.ENSP00000368678	0.979	Agrin
6	9606.ENSP00000217381	0.978	Alpha-1-syntrophin
7	9606.ENSP00000400365	0.953	Laminin subunit alpha-2
8	9606.ENSP00000354923	0.939	Dystrophin
9	9606.ENSP00000267257	0.938	Paxillin
10	9606.ENSP00000379350	0.935	Integrin beta-1
11	9606.ENSP00000378965	0.934	Beta-1-syntrophin
12	9606.ENSP00000362680	0.928	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000365745	0.928	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
14	9606.ENSP00000341189	0.925	Focal adhesion kinase 1
15	9606.ENSP00000385751	0.925	Serine/threonine-protein kinase MARK2
16	9606.ENSP00000258341	0.924	Laminin subunit gamma-1
17	9606.ENSP00000261007	0.922	Acetylcholine receptor subunit alpha
18	9606.ENSP00000324532	0.919	Laminin subunit alpha-3
19	9606.ENSP00000388325	0.918	Laminin subunit beta-2
20	9606.ENSP00000252999	0.917	Laminin subunit alpha-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.936	cytoskeletal protein binding
GO:0003779	0.826	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0061061	0.984	muscle structure development
GO:0065007	0.785	biological regulation
GO:0050789	0.782	regulation of biological process
GO:0050794	0.492	regulation of cellular process
GO:0009987	0.457	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0016020	0.996	membrane
GO:0005886	0.994	plasma membrane
GO:0032991	0.985	protein-containing complex
GO:0030054	0.983	cell junction
GO:0005622	0.964	intracellular anatomical structure
GO:0043226	0.929	organelle
GO:0043229	0.898	intracellular organelle
GO:0005737	0.893	cytoplasm
GO:0042383	0.859	sarcolemma
GO:0045202	0.858	synapse
GO:0016010	0.838	dystrophin-associated glycoprotein complex
GO:0043228	0.816	non-membrane-bounded organelle
GO:0031594	0.815	neuromuscular junction
GO:0043232	0.762	intracellular non-membrane-bounded organelle
GO:0043227	0.650	membrane-bounded organelle
GO:0005829	0.547	cytosol
GO:0043231	0.545	intracellular membrane-bounded organelle
GO:0005634	0.418	nucleus
GO:0012505	0.337	endomembrane system
GO:0042995	0.317	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]