StarFunc result for job id P46940

User Input

>input (1657 residues)
MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EINNMKTELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDRRIPADTFAAL
KNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNI
NKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQS
GQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ
VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLS
SSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERIL
AIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAV
LWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPEC
GETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQL
SREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAIT
CIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII
KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKA
LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
LLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDSSIRNMRA
VTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ
KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
NDPIHELLDDLGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMD
ARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKK
SKSVKEDSNLTLQEKKEKIQTGLKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRRK
AELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
LKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQ
DLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KFQ1	0.452	0.457	0.000	1639	0.567	0.574	A0A0G2KFQ1.pdb.gz
2	AFDB:A2CE93	0.481	0.476	0.000	1680	0.623	0.615	A2CE93.pdb.gz	A2CE93_DANRE IQ motif-containing GTPase-activating protein 2 OS=Danio rerio OX=7955 GN=fc20f09 PE=1 SV=1
3	AFDB:F8VQ29	0.415	0.421	0.000	1632	0.566	0.575	F8VQ29.pdb.gz	F8VQ29_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=1 SV=1
4	AFDB:G3V7Q7	0.508	0.508	0.000	1657	0.959	0.959	G3V7Q7.pdb.gz	G3V7Q7_RAT IQ motif containing GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=1 SV=1
5	AFDB:Q13576	0.255	0.268	0.000	1575	0.587	0.618	Q13576.pdb.gz	IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2 PE=1 SV=4
6	AFDB:Q3UQ44	0.509	0.534	0.000	1575	0.575	0.605	Q3UQ44.pdb.gz	IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus OX=10090 GN=Iqgap2 PE=1 SV=2
7	AFDB:Q86VI3	0.498	0.506	0.000	1631	0.584	0.593	Q86VI3.pdb.gz	IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=2
8	AFDB:O14188	0.225	0.249	7.370E-54	1489	0.249	0.277	O14188.pdb.gz	IQG1_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rng2 PE=1 SV=1
9	AFDB:Q54K32	0.348	0.652	1.358E-42	822	0.135	0.271	Q54K32.pdb.gz	RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum OX=44689 GN=rgaA PE=1 SV=1
10	AFDB:Q54I64	0.306	0.575	5.134E-40	817	0.129	0.261	Q54I64.pdb.gz	Q54I64_DICDI RasGTPase-activating protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288977 PE=4 SV=1
11	PDB:7r03B	0.152	0.115	6.373E-10	2246	0.110	0.081	7r03B.pdb.gz
12	PDB:7r04B	0.115	0.086	2.123E-9	2229	0.111	0.083	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
13	PDB:7r04A	0.160	0.115	2.724E-9	2326	0.115	0.082	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
14	PDB:7pgrN	0.172	0.122	9.862E-9	2423	0.135	0.092	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
15	PDB:7mp5A	0.158	0.161	6.124E-8	1629	0.103	0.105	7mp5A.pdb.gz
16	PDB:6r9tA	0.077	0.064	2.975E-3	2185	0.112	0.085	6r9tA.pdb.gz
17	PDB:1tr2B	0.062	0.082	1.170E-2	1029	0.090	0.145	1tr2B.pdb.gz
18	PDB:7ogtB	0.042	0.082	1.848E-2	708	0.061	0.143	7ogtB.pdb.gz
19	PDB:7w7gB	0.057	0.057	2.470E-2	1711	0.105	0.102	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.
20	PDB:7qcdB	0.032	0.051	3.900E-2	998	0.056	0.092	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A6YXJ2	0.0	702	626	0.218	0.578	A0A0A6YXJ2_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=1 SV=1
2	A0A0F7EVQ6	0.0	1911	1639	0.571	0.577	A0A0F7EVQ6_DANRE IQGAP3 protein OS=Danio rerio OX=7955 GN=IQGAP3 PE=1 SV=1
3	A0A8I6AJK7	0.0	3162	1638	0.937	0.948	A0A8I6AJK7_RAT IQ motif containing GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=1 SV=1
4	A2CE93	0.0	2071	1680	0.627	0.618	A2CE93_DANRE IQ motif-containing GTPase-activating protein 2 OS=Danio rerio OX=7955 GN=fc20f09 PE=1 SV=1
5	A2RRC9	0.0	1944	1631	0.586	0.595	A2RRC9_HUMAN IQ motif containing GTPase activating protein 3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=1
6	A4QPB0	0.0	3425	1657	0.999	0.999	A4QPB0_HUMAN IQ motif containing GTPase activating protein 1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1
7	B5DFH1	0.0	1951	969	0.568	0.972	B5DFH1_RAT Iqgap1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=2 SV=1
8	B9EKT6	0.0	1891	1632	0.572	0.580	B9EKT6_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=2 SV=1
9	F1QAC1	0.0	2077	1673	0.628	0.622	F1QAC1_DANRE IQ motif-containing GTPase-activating protein 2 OS=Danio rerio OX=7955 GN=si:ch211-157p10.1 PE=1 SV=2
10	F6WBH7	0.0	2852	1657	0.829	0.829	F6WBH7_XENTR IQ motif-containing GTPase-activating protein 1 OS=Xenopus tropicalis OX=8364 GN=iqgap1 PE=4 SV=4
11	F8VQ29	0.0	1891	1632	0.572	0.580	F8VQ29_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=1 SV=1
12	G3V7Q7	0.0	3259	1657	0.960	0.960	G3V7Q7_RAT IQ motif containing GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=1 SV=1
13	K9IWF9	0.0	3334	1657	0.969	0.969	K9IWF9_PIG Ras GTPase-activating-like protein IQGAP1 OS=Sus scrofa OX=9823 GN=IQGAP1 PE=1 SV=1
14	P46940	0.0	3427	1657	1.000	1.000	IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1
15	Q13576	0.0	1492	1575	0.463	0.487	IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2 PE=1 SV=4
16	Q3UQ44	0.0	1494	1575	0.447	0.470	IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus OX=10090 GN=Iqgap2 PE=1 SV=2
17	Q3UQP1	0.0	904	734	0.267	0.604	Q3UQP1_MOUSE IQ motif containing GTPase activating protein 3 OS=Mus musculus OX=10090 GN=Iqgap3 PE=1 SV=1
18	Q86VI3	0.0	1939	1631	0.585	0.595	IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=2
19	Q9JKF1	0.0	3256	1657	0.960	0.960	IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus OX=10090 GN=Iqgap1 PE=1 SV=2
20	O14188	1.50e-109	385	1489	0.174	0.194	IQG1_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rng2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	45	15.6	bZIP transcription factor
2	PF11971 CAMSAP_CH	80	14.5	CAMSAP CH domain
3	PF00307 CH	7.3e-16	69.7	Calponin homology (CH) domain
4	PF17365 DUF5390	4.4e+02	12.6	Family of unknown function (DUF5390)
5	PF00612 IQ	8.6e-14	61.0	IQ calmodulin-binding motif
6	PF00616 RasGAP	1.4e-56	203.1	GTPase-activator protein for Ras-like GTPase
7	PF03836 RasGAP_C	1.3e-35	133.9	RasGAP C-terminus
8	PF00397 WW	11	17.6	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268182

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261769	0.999	Cadherin-1
2	9606.ENSP00000344456	0.999	Catenin beta-1
3	9606.ENSP00000348461	0.999	Ras-related C3 botulinum toxin substrate 1
4	9606.ENSP00000383118	0.999	Cell division control protein 42 homolog
5	9606.ENSP00000400175	0.998	Transforming protein RhoA
6	9606.ENSP00000263923	0.997	Vascular endothelial growth factor receptor 2
7	9606.ENSP00000479322	0.997	CAP-Gly domain-containing linker protein 1
8	9606.ENSP00000302486	0.996	Dual specificity mitogen-activated protein kinase kinase 1
9	9606.ENSP00000398632	0.995	CD44 antigen
10	9606.ENSP00000223023	0.993	Neural Wiskott-Aldrich syndrome protein
11	9606.ENSP00000380378	0.990	Platelet-activating factor acetylhydrolase IB subunit alpha
12	9606.ENSP00000288602	0.989	Serine/threonine-protein kinase B-raf
13	9606.ENSP00000451828	0.988	RAC-alpha serine/threonine-protein kinase
14	9606.ENSP00000379975	0.987	Integrin-linked protein kinase
15	9606.ENSP00000378207	0.985	A-kinase anchor protein 5
16	9606.ENSP00000215832	0.983	Mitogen-activated protein kinase 1
17	9606.ENSP00000249071	0.981	Ras-related C3 botulinum toxin substrate 2
18	9606.ENSP00000251849	0.981	RAF proto-oncogene serine/threonine-protein kinase
19	9606.ENSP00000349467	0.980	Calmodulin-1
20	9606.ENSP00000370695	0.977	Exocyst complex component 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0019900	0.850	kinase binding
GO:0044877	0.848	protein-containing complex binding
GO:0019901	0.837	protein kinase binding
GO:0008092	0.829	cytoskeletal protein binding
GO:0051019	0.778	mitogen-activated protein kinase binding
GO:0031267	0.579	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009719	0.986	response to endogenous stimulus
GO:0033674	0.985	positive regulation of kinase activity
GO:0009987	0.984	cellular process
GO:0045859	0.977	regulation of protein kinase activity
GO:0045860	0.965	positive regulation of protein kinase activity
GO:0030155	0.945	regulation of cell adhesion
GO:0150116	0.941	regulation of cell-substrate junction organization
GO:0048583	0.937	regulation of response to stimulus
GO:0070849	0.931	response to epidermal growth factor
GO:0042221	0.929	response to chemical
GO:0009966	0.927	regulation of signal transduction
GO:0007165	0.927	signal transduction
GO:0010810	0.926	regulation of cell-substrate adhesion
GO:0043408	0.924	regulation of MAPK cascade
GO:1990776	0.924	response to angiotensin
GO:0044087	0.903	regulation of cellular component biogenesis
GO:1902533	0.899	positive regulation of intracellular signal transduction
GO:0001952	0.886	regulation of cell-matrix adhesion
GO:0031952	0.873	regulation of protein autophosphorylation
GO:1901888	0.866	regulation of cell junction assembly
GO:0007169	0.828	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0043410	0.822	positive regulation of MAPK cascade
GO:0040012	0.816	regulation of locomotion
GO:0030335	0.810	positive regulation of cell migration
GO:0050730	0.807	regulation of peptidyl-tyrosine phosphorylation
GO:0044089	0.793	positive regulation of cellular component biogenesis
GO:0071495	0.788	cellular response to endogenous stimulus
GO:0070887	0.769	cellular response to chemical stimulus
GO:0032880	0.761	regulation of protein localization
GO:0051130	0.761	positive regulation of cellular component organization
GO:0048519	0.751	negative regulation of biological process
GO:0071364	0.739	cellular response to epidermal growth factor stimulus
GO:0071900	0.712	regulation of protein serine/threonine kinase activity
GO:0048870	0.704	cell motility
GO:0045785	0.703	positive regulation of cell adhesion
GO:0071902	0.654	positive regulation of protein serine/threonine kinase activity
GO:0090109	0.635	regulation of cell-substrate junction assembly
GO:1903829	0.631	positive regulation of protein localization
GO:0010811	0.617	positive regulation of cell-substrate adhesion
GO:0051893	0.615	regulation of focal adhesion assembly
GO:0043406	0.606	positive regulation of MAP kinase activity
GO:0031346	0.581	positive regulation of cell projection organization
GO:0050793	0.580	regulation of developmental process
GO:0001954	0.551	positive regulation of cell-matrix adhesion
GO:0032502	0.544	developmental process
GO:0050731	0.536	positive regulation of peptidyl-tyrosine phosphorylation
GO:0071840	0.531	cellular component organization or biogenesis
GO:1901890	0.525	positive regulation of cell junction assembly
GO:0014910	0.517	regulation of smooth muscle cell migration
GO:0032501	0.501	multicellular organismal process
GO:0016043	0.494	cellular component organization
GO:0048856	0.488	anatomical structure development
GO:0050773	0.468	regulation of dendrite development
GO:0010976	0.467	positive regulation of neuron projection development
GO:0048523	0.446	negative regulation of cellular process
GO:0051094	0.439	positive regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070161	0.996	anchoring junction
GO:0005634	0.996	nucleus
GO:0005886	0.995	plasma membrane
GO:0120025	0.991	plasma membrane bounded cell projection
GO:0005925	0.991	focal adhesion
GO:0015629	0.990	actin cytoskeleton
GO:0005829	0.988	cytosol
GO:0032991	0.970	protein-containing complex
GO:0005576	0.968	extracellular region
GO:0031982	0.948	vesicle
GO:0012505	0.937	endomembrane system
GO:0043230	0.920	extracellular organelle
GO:1903561	0.895	extracellular vesicle
GO:0005615	0.877	extracellular space
GO:0070062	0.845	extracellular exosome
GO:0099080	0.730	supramolecular complex
GO:0031252	0.690	cell leading edge
GO:0031410	0.658	cytoplasmic vesicle
GO:0015630	0.609	microtubule cytoskeleton
GO:0031090	0.602	organelle membrane
GO:0070013	0.517	intracellular organelle lumen
GO:0031981	0.509	nuclear lumen
GO:0098857	0.476	membrane microdomain
GO:0005654	0.466	nucleoplasm
GO:0045121	0.415	membrane raft
GO:0099513	0.391	polymeric cytoskeletal fiber
GO:0098590	0.367	plasma membrane region
GO:0005911	0.319	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]