StarFunc result for job id P46952

User Input

>input (286 residues)
MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEG
DMVLRVLEQGKHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYV
GDTMDVLFEKWFYCKDLGTQLAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEP
MSLDAWLDSHHRELQAGTPLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVT
MGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPACKKPLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46952	1.000	1.000	2.917E-62	286	1.000	1.000	P46952.pdb.gz	3HAO_HUMAN 3-hydroxyanthranilate 3,4-dioxygenase OS=Homo sapiens OX=9606 GN=HAAO PE=1 SV=2
2	PDB:2qnkA	0.991	0.991	6.155E-57	286	0.997	0.997	2qnkA.pdb.gz
3	AFDB:P46953	0.996	0.996	1.836E-55	286	0.871	0.871	P46953.pdb.gz	3HAO_RAT 3-hydroxyanthranilate 3,4-dioxygenase OS=Rattus norvegicus OX=10116 GN=Haao PE=1 SV=2
4	PDB:1zvfA	0.508	0.812	4.093E-17	176	0.231	0.375	1zvfA.pdb.gz
5	AFDB:P47096	0.513	0.817	4.888E-17	177	0.227	0.367	P47096.pdb.gz	3HAO_YEAST 3-hydroxyanthranilate 3,4-dioxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA1 PE=1 SV=1
6	AFDB:B3STU4	0.374	0.166	1.728E-12	792	0.157	0.057	B3STU4.pdb.gz	VCL_CARIL Vicilin Car i 2.0101 OS=Carya illinoinensis OX=32201 GN=pec2a1a PE=1 SV=1
7	PDB:1uijC	0.342	0.298	2.637E-12	346	0.115	0.095	1uijC.pdb.gz
8	AFDB:Q9SK09	0.378	0.239	7.538E-12	511	0.105	0.059	Q9SK09.pdb.gz	VCL22_ARATH Vicilin-like seed storage protein At2g28490 OS=Arabidopsis thaliana OX=3702 GN=At2g28490 PE=2 SV=1
9	PDB:2vqaA	0.405	0.340	7.852E-12	356	0.147	0.118	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
10	PDB:4lejA	0.405	0.341	7.852E-12	355	0.129	0.104	4lejA.pdb.gz	Crystal Structure of Korean Pine ( Pinus koraiensis ) 7S Seed Storage Protein with Copper Ligands.
11	AFDB:O34767	0.424	0.331	1.046E-11	392	0.154	0.112	O34767.pdb.gz	OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) OX=224308 GN=oxdD PE=1 SV=1
12	PDB:1ipkC	0.363	0.290	1.431E-11	379	0.147	0.111	1ipkC.pdb.gz
13	AFDB:P73510	0.415	0.322	1.451E-11	394	0.147	0.107	P73510.pdb.gz	P73510_SYNY3 Sll1358 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1358 PE=1 SV=1
14	PDB:6l4cC	0.363	0.310	2.607E-11	353	0.136	0.110	6l4cC.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
15	AFDB:Q8S4P9	0.384	0.270	3.113E-11	448	0.150	0.096	Q8S4P9.pdb.gz	VCL_CORAV Vicilin Cor a 11.0101 OS=Corylus avellana OX=13451 PE=1 SV=1
16	AFDB:A0A2I4E5L6	0.386	0.249	3.288E-11	502	0.133	0.076	A0A2I4E5L6.pdb.gz	VCL6_JUGRE Vicilin Jug r 6.0101 OS=Juglans regia OX=51240 GN=LOC108986502 PE=1 SV=1
17	AFDB:Q9LUJ7	0.361	0.240	3.667E-11	486	0.147	0.086	Q9LUJ7.pdb.gz	PAP85_ARATH Vicilin-like seed storage protein At3g22640 OS=Arabidopsis thaliana OX=3702 GN=PAP85 PE=2 SV=1
18	PDB:6l4cB	0.361	0.298	1.577E-10	373	0.143	0.110	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
19	PDB:1fxzA	0.421	0.342	3.035E-10	371	0.112	0.086	1fxzA.pdb.gz
20	PDB:5wpwA	0.430	0.343	3.205E-10	379	0.108	0.082	5wpwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P46952	0.0	590	286	1.000	1.000	3HAO_HUMAN 3-hydroxyanthranilate 3,4-dioxygenase OS=Homo sapiens OX=9606 GN=HAAO PE=1 SV=2
2	P46953	0.0	521	286	0.871	0.871	3HAO_RAT 3-hydroxyanthranilate 3,4-dioxygenase OS=Rattus norvegicus OX=10116 GN=Haao PE=1 SV=2
3	Q78JT3	0.0	508	286	0.853	0.853	3HAO_MOUSE 3-hydroxyanthranilate 3,4-dioxygenase OS=Mus musculus OX=10090 GN=Haao PE=1 SV=1
4	P47096	1.68e-35	127	177	0.227	0.367	3HAO_YEAST 3-hydroxyanthranilate 3,4-dioxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA1 PE=1 SV=1
5	Q852L2	0.47	34.3	470	0.045	0.028	CUCIN_ORYSJ Cupincin OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0793700 PE=1 SV=2
6	B8AL97	0.49	34.3	470	0.045	0.028	CUCIN_ORYSI Cupincin OS=Oryza sativa subsp. indica OX=39946 GN=OsI_13867 PE=1 SV=1
7	Q8R2F2	0.85	33.5	323	0.077	0.068	DEGS2_MOUSE Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Mus musculus OX=10090 GN=Degs2 PE=1 SV=1
8	F2X2F3	1.3	32.0	172	0.063	0.105	F2X2F3_BOVIN Insulin-like growth factor I OS=Bos taurus OX=9913 GN=IGF1 PE=2 SV=1
9	P11717	1.6	33.1	2491	0.101	0.012	MPRI_HUMAN Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3
10	Q498I0	1.8	32.7	776	0.105	0.039	Q498I0_XENLA LOC445850 protein OS=Xenopus laevis OX=8355 GN=zw10.L PE=2 SV=1
11	F2X2F1	2.3	31.6	188	0.063	0.096	F2X2F1_BOVIN Insulin-like growth factor I OS=Bos taurus OX=9913 GN=IGF1 PE=2 SV=1
12	G3V824	3.0	32.0	2481	0.122	0.014	G3V824_RAT Insulin-like growth factor 2 receptor OS=Rattus norvegicus OX=10116 GN=Igf2r PE=1 SV=1
13	A0A8I6GLL6	3.1	32.0	2479	0.122	0.014	A0A8I6GLL6_RAT Insulin-like growth factor 2 receptor OS=Rattus norvegicus OX=10116 GN=Igf2r PE=1 SV=1
14	A0A8I6AI55	3.3	32.0	2439	0.122	0.014	A0A8I6AI55_RAT Insulin-like growth factor 2 receptor OS=Rattus norvegicus OX=10116 GN=Igf2r PE=1 SV=1
15	Q75GX9	3.9	31.6	562	0.052	0.027	GLB63_ORYSJ 63 kDa globulin-like protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0663800 PE=1 SV=1
16	O14356	5.2	31.2	2335	0.052	0.006	TOR1_SCHPO Serine/threonine-protein kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tor1 PE=1 SV=1
17	O43264	5.6	31.2	779	0.070	0.026	ZW10_HUMAN Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10 PE=1 SV=3
18	P08169	5.9	31.2	2499	0.122	0.014	MPRI_BOVIN Cation-independent mannose-6-phosphate receptor OS=Bos taurus OX=9913 GN=IGF2R PE=1 SV=2
19	F1MIE6	6.0	31.2	2499	0.094	0.011	F1MIE6_BOVIN Insulin like growth factor 2 receptor OS=Bos taurus OX=9913 GN=IGF2R PE=4 SV=3
20	Q07113	6.4	31.2	2483	0.091	0.010	MPRI_MOUSE Cation-independent mannose-6-phosphate receptor OS=Mus musculus OX=10090 GN=Igf2r PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06052 3-HAO	5.8e-77	268.0	3-hydroxyanthranilic acid dioxygenase
2	PF02311 AraC_binding	4.9	18.5	AraC-like ligand binding domain
3	PF00190 Cupin_1	66	14.5	Cupin
4	PF07883 Cupin_2	3.5e-07	41.2	Cupin domain
5	PF05899 Cupin_3	9.2	17.3	EutQ-like cupin domain
6	PF08007 JmjC_2	4.3e+02	11.8	JmjC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294973

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264170	0.998	Kynureninase
2	9606.ENSP00000348459	0.989	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
3	9606.ENSP00000355517	0.986	Kynurenine 3-monooxygenase
4	9606.ENSP00000241052	0.909	Catalase
5	9606.ENSP00000378782	0.904	Nicotinate-nucleotide pyrophosphorylase [carboxylating]
6	9606.ENSP00000350928	0.878	Glutamate decarboxylase 1
7	9606.ENSP00000444788	0.867	Tryptophan 2,3-dioxygenase
8	9606.ENSP00000423190	0.817	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
9	9606.ENSP00000399415	0.779	Kynurenine--oxoglutarate transaminase 1
10	9606.ENSP00000448059	0.774	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
11	9606.ENSP00000283871	0.760	Homogentisate 1,2-dioxygenase
12	9606.ENSP00000401508	0.748	Nicotinate phosphoribosyltransferase
13	9606.ENSP00000385080	0.726	Fumarylacetoacetase
14	9606.ENSP00000443432	0.706	Indoleamine 2,3-dioxygenase 2
15	9606.ENSP00000328938	0.688	Kynurenine formamidase
16	9606.ENSP00000260508	0.664	Kynurenine--oxoglutarate transaminase 3
17	9606.ENSP00000291670	0.653	Formimidoyltransferase-cyclodeaminase
18	9606.ENSP00000307640	0.649	Tetratricopeptide repeat domain containing
19	9606.ENSP00000326424	0.648	Glutamine-dependent NAD(+) synthetase
20	9606.ENSP00000426120	0.638	GRAM domain-containing protein 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000334	1.000	3-hydroxyanthranilate 3,4-dioxygenase activity
GO:0005506	0.999	iron ion binding
GO:0005515	0.998	protein binding
GO:0008198	0.825	ferrous iron binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0043436	0.989	oxoacid metabolic process
GO:1901360	0.988	organic cyclic compound metabolic process
GO:0046483	0.986	heterocycle metabolic process
GO:1901564	0.985	organonitrogen compound metabolic process
GO:0019752	0.983	carboxylic acid metabolic process
GO:0034641	0.982	cellular nitrogen compound metabolic process
GO:0044238	0.976	primary metabolic process
GO:0072524	0.974	pyridine-containing compound metabolic process
GO:0043648	0.968	dicarboxylic acid metabolic process
GO:0006725	0.685	cellular aromatic compound metabolic process
GO:0006139	0.494	nucleobase-containing compound metabolic process
GO:0009058	0.489	biosynthetic process
GO:0065007	0.459	biological regulation
GO:0050789	0.428	regulation of biological process
GO:0050794	0.396	regulation of cellular process
GO:0044249	0.324	cellular biosynthetic process
GO:1901576	0.318	organic substance biosynthetic process
GO:0009117	0.306	nucleotide metabolic process
GO:0046496	0.304	nicotinamide nucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.995	membrane
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005829	0.963	cytosol
GO:0005739	0.739	mitochondrion
GO:0031090	0.586	organelle membrane
GO:0031975	0.487	envelope
GO:0031967	0.420	organelle envelope
GO:0031966	0.302	mitochondrial membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17953	1.000	3-hydroxyanthranilate + O2 = (2Z,4Z)-2-amino-3-carboxymuconate 6-semialdehyde
EC:1.13.11.6	1.000	3-hydroxyanthranilate 3,4-dioxygenase.

[back to server]