StarFunc result for job id P46977

User Input

>input (705 residues)
MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFL
AEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLA
PLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTY
YMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAY
CTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFR
SVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSY
YFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGI
GVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTS
EAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTI
LVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV
RIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGF
DRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGLSRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1PJP5	0.992	0.992	1.186E-92	705	0.994	0.994	F1PJP5.pdb.gz	STT3A_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3
2	AFDB:Q9VRE0	0.970	0.960	4.472E-82	713	0.765	0.756	Q9VRE0.pdb.gz	Q9VRE0_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Drosophila melanogaster OX=7227 GN=Stt3A PE=1 SV=1
3	PDB:6s7oA	0.919	0.987	3.586E-77	656	0.930	1.000	6s7oA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
4	AFDB:Q9FX21	0.966	0.927	1.817E-73	735	0.603	0.578	Q9FX21.pdb.gz	STT3B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Arabidopsis thaliana OX=3702 GN=STT3B PE=2 SV=1
5	AFDB:Q7KN63	0.951	0.842	7.214E-72	797	0.582	0.514	Q7KN63.pdb.gz	Q7KN63_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Stt3B PE=2 SV=1
6	AFDB:E2RG47	0.951	0.814	7.847E-71	826	0.600	0.512	E2RG47.pdb.gz	STT3B_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
7	AFDB:Q5ALU8	0.936	0.880	3.687E-67	751	0.559	0.525	Q5ALU8.pdb.gz	Q5ALU8_CANAL dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STT3 PE=3 SV=1
8	AFDB:O94335	0.940	0.882	1.017E-65	752	0.532	0.499	O94335.pdb.gz	STT3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
9	PDB:6s7tA	0.940	0.938	2.490E-65	706	0.591	0.591	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
10	AFDB:P39007	0.940	0.923	7.090E-65	718	0.532	0.522	P39007.pdb.gz	STT3_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
11	AFDB:Q93ZY3	0.929	0.842	1.663E-63	779	0.536	0.485	Q93ZY3.pdb.gz	STT3A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Arabidopsis thaliana OX=3702 GN=STT3A PE=2 SV=1
12	PDB:6eznF	0.836	0.905	7.465E-51	650	0.481	0.522	6eznF.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
13	AFDB:Q57W35	0.855	0.739	3.142E-42	821	0.312	0.268	Q57W35.pdb.gz	Q57W35_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.500 PE=3 SV=1
14	PDB:5oglA	0.596	0.595	3.338E-13	707	0.146	0.146	5oglA.pdb.gz	Molecular basis of lipid-linked oligosaccharide recognition and processing by bacterial oligosaccharyltransferase.
15	PDB:3rceA	0.570	0.586	7.807E-13	683	0.143	0.148	3rceA.pdb.gz	X-ray structure of a bacterial oligosaccharyltransferase.
16	PDB:6p25A	0.248	0.240	4.580E-3	731	0.060	0.057	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
17	PDB:6p25B	0.238	0.243	5.607E-3	690	0.047	0.048	6p25B.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
18	PDB:7w72U	0.247	0.376	6.591E-3	420	0.087	0.145	7w72U.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
19	PDB:3waiA	0.091	0.090	1.480E-2	711	0.065	0.065	3waiA.pdb.gz
20	PDB:4gbyA	0.077	0.105	8.430E-2	475	0.082	0.122	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E2RG47	0.0	872	826	0.607	0.518	STT3B_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
2	F1PJP5	0.0	1452	705	0.996	0.996	STT3A_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3
3	O94335	0.0	774	752	0.538	0.504	STT3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
4	P39007	0.0	733	718	0.539	0.529	STT3_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
5	P46977	0.0	1460	705	1.000	1.000	STT3A_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2
6	P46978	0.0	1452	705	0.994	0.994	STT3A_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Mus musculus OX=10090 GN=Stt3a PE=1 SV=1
7	Q5ALU8	0.0	798	751	0.555	0.521	Q5ALU8_CANAL dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STT3 PE=3 SV=1
8	Q7KN63	0.0	843	797	0.584	0.517	Q7KN63_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Stt3B PE=2 SV=1
9	Q8TCJ2	0.0	873	826	0.607	0.518	STT3B_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
10	Q93ZY3	0.0	727	779	0.536	0.485	STT3A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Arabidopsis thaliana OX=3702 GN=STT3A PE=2 SV=1
11	Q9FX21	0.0	858	735	0.601	0.577	STT3B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Arabidopsis thaliana OX=3702 GN=STT3B PE=2 SV=1
12	Q9VRE0	0.0	1153	713	0.767	0.759	Q9VRE0_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Drosophila melanogaster OX=7227 GN=Stt3A PE=1 SV=1
13	Q9XZ53	0.0	843	774	0.584	0.532	Q9XZ53_DROME dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Drosophila melanogaster OX=7227 GN=Stt3B PE=1 SV=1
14	Q57W35	1.96e-105	342	821	0.312	0.268	Q57W35_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.500 PE=3 SV=1
15	Q57W36	5.30e-102	332	821	0.315	0.270	Q57W36_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.490 PE=3 SV=1
16	Q57W34	5.54e-99	324	801	0.315	0.277	Q57W34_TRYB2 dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.510 PE=3 SV=1
17	Q2EMT4	0.002	43.9	917	0.048	0.037	AGLB_METVO Dolichyl-phosphooligosaccharide-protein glycotransferase OS=Methanococcus voltae OX=2188 GN=aglB PE=1 SV=1
18	D4GYH4	1.3	35.0	1054	0.055	0.037	AGLB_HALVD Dolichyl-monophosphooligosaccharide--protein glycotransferase AglB OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglB PE=1 SV=1
19	P34413	3.5	33.5	683	0.068	0.070	DPY19_CAEEL C-mannosyltransferase dpy-19 OS=Caenorhabditis elegans OX=6239 GN=dpy-19 PE=1 SV=2
20	A0A140VK66	7.0	32.3	1066	0.024	0.016	A0A140VK66_HUMAN Testicular secretory protein Li 66 OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11204 DUF2985	9.6e+02	11.4	Protein of unknown function (DUF2985)
2	PF19626 DUF6131	11	17.6	Family of unknown function (DUF6131)
3	PF20604 DUF6798	55	15.0	Domain of unknown function (DUF6798)
4	PF13231 PMT_2	0.19	23.5	Dolichyl-phosphate-mannose-protein mannosyltransferase
5	PF02516 STT3	1.6e-162	553.5	Oligosaccharyl transferase STT3 subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009071

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007603	0.999	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol- pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme a [...]
2	61853.ENSNLEP00000009685	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
3	61853.ENSNLEP00000017447	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
4	61853.ENSNLEP00000017845	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
5	61853.ENSNLEP00000002783	0.996	Tumor suppressor candidate 3
6	61853.ENSNLEP00000005084	0.982	STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
7	61853.ENSNLEP00000015687	0.979	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol- pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme a [...]
8	61853.ENSNLEP00000020205	0.976	ALG10, alpha-1,2-glucosyltransferase
9	61853.ENSNLEP00000023224	0.976	ALG10B, alpha-1,2-glucosyltransferase
10	61853.ENSNLEP00000001571	0.958	Magnesium transporter 1
11	61853.ENSNLEP00000000783	0.948	Mannosyl-oligosaccharide glucosidase
12	61853.ENSNLEP00000021408	0.911	Dolichyldiphosphatase 1
13	61853.ENSNLEP00000017363	0.880	Sec61 alpha 1 subunit (S. cerevisiae)
14	61853.ENSNLEP00000016492	0.816	Signal sequence receptor, delta
15	61853.ENSNLEP00000020712	0.816	Protein transport protein Sec61 subunit beta
16	61853.ENSNLEP00000014424	0.810	Keratinocyte associated protein 2
17	61853.ENSNLEP00000014968	0.809	Sec61 alpha 2 subunit (S. cerevisiae)
18	61853.ENSNLEP00000004795	0.790	Signal sequence receptor, gamma (translocon-associated protein gamma)
19	61853.ENSNLEP00000004418	0.753	Signal recognition particle receptor, B subunit
20	61853.ENSNLEP00000019329	0.753	Signal peptide peptidase like 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004579	1.000	dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006486	0.997	protein glycosylation
GO:0006487	0.988	protein N-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005783	0.999	endoplasmic reticulum
GO:0032991	0.997	protein-containing complex
GO:0140534	0.989	endoplasmic reticulum protein-containing complex
GO:1902494	0.987	catalytic complex
GO:0005789	0.987	endoplasmic reticulum membrane
GO:0098796	0.986	membrane protein complex
GO:1990234	0.981	transferase complex
GO:0008250	0.967	oligosaccharyltransferase complex
GO:0005634	0.347	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22980	1.000	a dolichyl diphosphooligosaccharide + L-asparaginyl-[protein] = a dolichyl diphosphate + H(+) + N(4)-(oligosaccharide-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl)-L-asparaginy-[protein]
EC:2.4.99.18	1.000	dolichyl-diphosphooligosaccharide--protein glycotransferase.

[back to server]