StarFunc result for job id P47710

User Input

>input (185 residues)
MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQ
TDEIKDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQ
EQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNN
VMLQW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47710	1.000	1.000	2.656E-28	185	1.000	1.000	P47710.pdb.gz	CASA1_HUMAN Alpha-S1-casein OS=Homo sapiens OX=9606 GN=CSN1S1 PE=1 SV=1
2	AFDB:G5EG44	0.219	0.149	4.620E-1	281	0.130	0.085	G5EG44.pdb.gz	MDL1_CAEEL Mad-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=mdl-1 PE=1 SV=1
3	AFDB:Q9VUR6	0.199	0.055	5.346E-1	896	0.146	0.030	Q9VUR6.pdb.gz	Q9VUR6_DROME Rho GTPase activating protein at 71E, isoform C OS=Drosophila melanogaster OX=7227 GN=RhoGAP71E PE=1 SV=2
4	AFDB:Q8W2F2	0.196	0.137	1.192	286	0.151	0.098	Q8W2F2.pdb.gz	BH011_ARATH Transcription factor bHLH11 OS=Arabidopsis thaliana OX=3702 GN=BHLH11 PE=2 SV=2
5	AFDB:Q54G14	0.215	0.053	1.283	1081	0.151	0.026	Q54G14.pdb.gz	Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0290685 PE=2 SV=2
6	AFDB:Q9W0C1	0.186	0.188	1.283	183	0.119	0.120	Q9W0C1.pdb.gz	NSYB_DROME Neuronal synaptobrevin OS=Drosophila melanogaster OX=7227 GN=nSyb PE=1 SV=1
7	AFDB:Q4GYH3	0.222	0.088	1.380	539	0.092	0.032	Q4GYH3.pdb.gz	Q4GYH3_TRYB2 LisH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4040 PE=4 SV=1
8	AFDB:Q9T0A6	0.115	0.109	1.847	198	0.151	0.141	Q9T0A6.pdb.gz	Q9T0A6_ARATH At4g23910 OS=Arabidopsis thaliana OX=3702 GN=UIEF2 PE=1 SV=1
9	AFDB:Q54TY7	0.244	0.112	1.987	418	0.157	0.069	Q54TY7.pdb.gz	SRFA_DICDI Serum response factor homolog A OS=Dictyostelium discoideum OX=44689 GN=srfA PE=1 SV=1
10	AFDB:Q92617	0.154	0.037	1.987	1050	0.135	0.024	Q92617.pdb.gz	NPIB3_HUMAN Nuclear pore complex-interacting protein family member B3 OS=Homo sapiens OX=9606 GN=NPIPB3 PE=1 SV=5
11	PDB:6ip52V	0.124	0.198	5.551	109	0.086	0.147	6ip52V.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.
12	PDB:7mqaNA	0.085	0.062	5.971	295	0.184	0.115	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:4v60A	0.184	0.048	6.909	812	0.114	0.026	4v60A.pdb.gz
14	PDB:6v92R	0.205	0.121	8.599	325	0.119	0.068	6v92R.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
15	PDB:6hivCR	0.197	0.137	9.949	314	0.076	0.045	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47710	9.58e-136	378	185	1.000	1.000	CASA1_HUMAN Alpha-S1-casein OS=Homo sapiens OX=9606 GN=CSN1S1 PE=1 SV=1
2	P02662	1.05e-17	79.3	214	0.400	0.346	CASA1_BOVIN Alpha-S1-casein OS=Bos taurus OX=9913 GN=CSN1S1 PE=1 SV=2
3	B5B3R8	5.27e-17	77.4	214	0.395	0.341	B5B3R8_BOVIN Alpha-S1-casein OS=Bos taurus OX=9913 GN=CSN1S1 PE=2 SV=1
4	P19228	2.19e-07	52.0	313	0.297	0.176	CASA1_MOUSE Alpha-S1-casein OS=Mus musculus OX=10090 GN=Csn1s1 PE=2 SV=1
5	P02661	2.85e-07	51.2	284	0.195	0.127	CASA1_RAT Alpha-S1-casein OS=Rattus norvegicus OX=10116 GN=Csn1s1 PE=1 SV=1
6	C1P633	0.35	33.9	1054	0.151	0.027	C1P633_CAEEL MAGI (Membrane Associated Guanylate kinase Inverted) homolog OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
7	C6KRJ8	0.42	33.5	802	0.151	0.035	C6KRJ8_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
8	D3YT29	0.48	33.5	829	0.151	0.034	D3YT29_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
9	C1P634	0.54	33.1	855	0.151	0.033	C1P634_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
10	C1P635	0.56	33.1	1004	0.151	0.028	C1P635_CAEEL MAGI (Membrane Associated Guanylate kinase Inverted) homolog OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=2
11	X6REB3	4.9	30.0	679	0.195	0.053	X6REB3_HUMAN Transcription factor 3 OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=2
12	Q55434	7.3	29.6	1276	0.059	0.009	PHY2_SYNY3 Phytochrome-like protein cph2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=cph2 PE=1 SV=1
13	Q43128	8.1	29.6	947	0.081	0.016	PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana OX=3702 GN=AHA10 PE=2 SV=2
14	P02663	9.1	28.9	222	0.054	0.045	CASA2_BOVIN Alpha-S2-casein OS=Bos taurus OX=9913 GN=CSN1S2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00363 Casein	1.8e+02	13.9	Casein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246891

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341030	0.976	Beta-casein
2	9606.ENSP00000304822	0.940	Kappa-casein
3	9606.ENSP00000301046	0.882	Alpha-lactalbumin
4	9606.ENSP00000417898	0.739	Glycodelin
5	9606.ENSP00000394510	0.693	Proline-rich protein 12
6	9606.ENSP00000246794	0.677	Transmembrane gamma-carboxyglutamic acid protein 2
7	9606.ENSP00000244513	0.616	Butyrophilin subfamily 1 member A1
8	9606.ENSP00000482264	0.552	Diacylglycerol O-acyltransferase 1
9	9606.ENSP00000363089	0.510	Toll-like receptor 4
10	9606.ENSP00000302150	0.508	Prolactin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.987	regulation of cellular process
GO:0080090	0.974	regulation of primary metabolic process
GO:0042221	0.971	response to chemical
GO:0048518	0.969	positive regulation of biological process
GO:0051239	0.965	regulation of multicellular organismal process
GO:0009889	0.963	regulation of biosynthetic process
GO:0010033	0.937	response to organic substance
GO:0065008	0.930	regulation of biological quality
GO:0048522	0.929	positive regulation of cellular process
GO:0010817	0.923	regulation of hormone levels
GO:0009719	0.919	response to endogenous stimulus
GO:1901654	0.890	response to ketone
GO:0048545	0.880	response to steroid hormone
GO:0032570	0.871	response to progesterone
GO:0051049	0.869	regulation of transport
GO:0031960	0.863	response to corticosteroid
GO:0097305	0.843	response to alcohol
GO:0009893	0.842	positive regulation of metabolic process
GO:0031323	0.822	regulation of cellular metabolic process
GO:0048519	0.783	negative regulation of biological process
GO:0048523	0.716	negative regulation of cellular process
GO:0019216	0.716	regulation of lipid metabolic process
GO:0031325	0.688	positive regulation of cellular metabolic process
GO:0009987	0.660	cellular process
GO:0023051	0.656	regulation of signaling
GO:0010646	0.655	regulation of cell communication
GO:0023056	0.584	positive regulation of signaling
GO:0010647	0.584	positive regulation of cell communication
GO:0050793	0.563	regulation of developmental process
GO:0031326	0.533	regulation of cellular biosynthetic process
GO:0051050	0.484	positive regulation of transport
GO:0009891	0.469	positive regulation of biosynthetic process
GO:0019218	0.411	regulation of steroid metabolic process
GO:0044057	0.408	regulation of system process
GO:0032368	0.407	regulation of lipid transport
GO:0051046	0.404	regulation of secretion
GO:0031328	0.384	positive regulation of cellular biosynthetic process
GO:0051240	0.368	positive regulation of multicellular organismal process
GO:0060255	0.337	regulation of macromolecule metabolic process
GO:0032502	0.324	developmental process
GO:0051094	0.308	positive regulation of developmental process
GO:0048856	0.305	anatomical structure development
GO:0042981	0.305	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005622	0.929	intracellular anatomical structure
GO:0043227	0.916	membrane-bounded organelle
GO:0043231	0.914	intracellular membrane-bounded organelle
GO:0005737	0.884	cytoplasm
GO:0012505	0.722	endomembrane system
GO:0070013	0.506	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]