StarFunc result for job id P47712

User Input

>input (749 residues)
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50393	0.967	0.963	0.000	752	0.943	0.939	P50393.pdb.gz	PA24A_RAT Cytosolic phospholipase A2 OS=Rattus norvegicus OX=10116 GN=Pla2g4a PE=1 SV=1
2	PDB:1cjyA	0.837	0.989	1.566E-99	633	0.844	0.998	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
3	AFDB:A0A0R4ICC9	0.888	0.922	1.731E-94	720	0.685	0.713	A0A0R4ICC9.pdb.gz
4	AFDB:P50392	0.873	0.882	2.549E-94	741	0.704	0.711	P50392.pdb.gz	PA24A_DANRE Cytosolic phospholipase A2 OS=Danio rerio OX=7955 GN=pla2g4a PE=2 SV=1
5	AFDB:Q3MJ16	0.600	0.522	1.449E-51	868	0.303	0.262	Q3MJ16.pdb.gz	PA24E_HUMAN Cytosolic phospholipase A2 epsilon OS=Homo sapiens OX=9606 GN=PLA2G4E PE=1 SV=4
6	AFDB:Q50L43	0.641	0.585	6.190E-51	825	0.286	0.259	Q50L43.pdb.gz	PA24D_MOUSE Cytosolic phospholipase A2 delta OS=Mus musculus OX=10090 GN=Pla2g4d PE=1 SV=3
7	AFDB:Q50L41	0.648	0.572	7.512E-51	855	0.290	0.254	Q50L41.pdb.gz	PA24F_MOUSE Cytosolic phospholipase A2 zeta OS=Mus musculus OX=10090 GN=Pla2g4f PE=1 SV=3
8	AFDB:P0C871	0.639	0.614	8.049E-50	782	0.284	0.272	P0C871.pdb.gz	PA24B_MOUSE Cytosolic phospholipase A2 beta OS=Mus musculus OX=10090 GN=Pla2g4b PE=1 SV=1
9	AFDB:Q68DD2	0.630	0.561	1.833E-49	849	0.307	0.271	Q68DD2.pdb.gz	PA24F_HUMAN Cytosolic phospholipase A2 zeta OS=Homo sapiens OX=9606 GN=PLA2G4F PE=1 SV=3
10	AFDB:P0C869	0.614	0.590	2.224E-49	781	0.252	0.242	P0C869.pdb.gz	PA24B_HUMAN Cytosolic phospholipase A2 beta OS=Homo sapiens OX=9606 GN=PLA2G4B PE=1 SV=2
11	AFDB:Q50L42	0.586	0.505	2.833E-49	875	0.288	0.247	Q50L42.pdb.gz	PA24E_MOUSE Cytosolic phospholipase A2 epsilon OS=Mus musculus OX=10090 GN=Pla2g4e PE=1 SV=1
12	PDB:5iz5A	0.616	0.610	5.294E-47	757	0.270	0.267	5iz5A.pdb.gz
13	PDB:5iz5B	0.591	0.593	1.996E-45	746	0.262	0.263	5iz5B.pdb.gz
14	PDB:5ixcA	0.560	0.610	8.644E-42	684	0.255	0.279	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5izrC	0.529	0.598	1.147E-39	659	0.248	0.282	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:3nsjA	0.139	0.195	1.097E-6	530	0.029	0.042	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
17	PDB:5a52A	0.134	0.593	1.331E-6	154	0.028	0.136	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5a50A	0.141	0.590	4.252E-6	165	0.031	0.139	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:4rj9A	0.127	0.529	4.917E-6	161	0.033	0.155	4rj9A.pdb.gz
20	PDB:3pfqA	0.116	0.163	4.556E-5	523	0.055	0.078	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47712	0.0	1556	749	1.000	1.000	PA24A_HUMAN Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2
2	P47713	0.0	1458	748	0.944	0.945	PA24A_MOUSE Cytosolic phospholipase A2 OS=Mus musculus OX=10090 GN=Pla2g4a PE=1 SV=1
3	P50392	0.0	1103	741	0.716	0.723	PA24A_DANRE Cytosolic phospholipase A2 OS=Danio rerio OX=7955 GN=pla2g4a PE=2 SV=1
4	P50393	0.0	1460	752	0.944	0.940	PA24A_RAT Cytosolic phospholipase A2 OS=Rattus norvegicus OX=10116 GN=Pla2g4a PE=1 SV=1
5	Q68DD2	1.56e-93	312	849	0.291	0.257	PA24F_HUMAN Cytosolic phospholipase A2 zeta OS=Homo sapiens OX=9606 GN=PLA2G4F PE=1 SV=3
6	Q50L41	4.44e-91	305	855	0.284	0.249	PA24F_MOUSE Cytosolic phospholipase A2 zeta OS=Mus musculus OX=10090 GN=Pla2g4f PE=1 SV=3
7	Q50L42	5.87e-84	286	875	0.263	0.225	PA24E_MOUSE Cytosolic phospholipase A2 epsilon OS=Mus musculus OX=10090 GN=Pla2g4e PE=1 SV=1
8	Q3MJ16	1.77e-83	285	868	0.256	0.221	PA24E_HUMAN Cytosolic phospholipase A2 epsilon OS=Homo sapiens OX=9606 GN=PLA2G4E PE=1 SV=4
9	P0C871	7.65e-78	268	782	0.243	0.233	PA24B_MOUSE Cytosolic phospholipase A2 beta OS=Mus musculus OX=10090 GN=Pla2g4b PE=1 SV=1
10	Q50L43	1.63e-75	263	825	0.260	0.236	PA24D_MOUSE Cytosolic phospholipase A2 delta OS=Mus musculus OX=10090 GN=Pla2g4d PE=1 SV=3
11	Q86XP0	8.30e-73	255	818	0.250	0.229	PA24D_HUMAN Cytosolic phospholipase A2 delta OS=Homo sapiens OX=9606 GN=PLA2G4D PE=1 SV=2
12	P0C869	8.71e-64	229	781	0.250	0.239	PA24B_HUMAN Cytosolic phospholipase A2 beta OS=Homo sapiens OX=9606 GN=PLA2G4B PE=1 SV=2
13	Q9UP65	1.81e-44	170	541	0.182	0.251	PA24C_HUMAN Cytosolic phospholipase A2 gamma OS=Homo sapiens OX=9606 GN=PLA2G4C PE=1 SV=2
14	Q64GA5	1.17e-31	133	597	0.126	0.157	PA24C_MOUSE Cytosolic phospholipase A2 gamma OS=Mus musculus OX=10090 GN=Pla2g4c PE=1 SV=1
15	Q9UWF6	3.68e-11	68.9	605	0.081	0.101	PLB1_CANAL Lysophospholipase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PLB1 PE=1 SV=1
16	Q8TG07	4.68e-11	68.6	659	0.111	0.126	PLB1_CANGA Lysophospholipase 1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PLB1 PE=3 SV=2
17	P39105	5.08e-11	68.6	664	0.087	0.098	PLB1_YEAST Lysophospholipase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PLB1 PE=1 SV=2
18	Q9LEX1	7.67e-08	58.2	510	0.041	0.061	CLB_ARATH Calcium-dependent lipid-binding protein OS=Arabidopsis thaliana OX=3702 GN=CLB PE=1 SV=1
19	Q03674	9.87e-08	57.8	706	0.080	0.085	PLB2_YEAST Lysophospholipase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PLB2 PE=1 SV=1
20	G8BA46	1.14e-07	57.8	724	0.099	0.102	G8BA46_CANPC Lysophospholipase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=PLB5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.1e-12	58.6	C2 domain
2	PF01735 PLA2_B	1.4e-145	497.1	Lysophospholipase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356436

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215832	0.962	Mitogen-activated protein kinase 1
2	9606.ENSP00000263025	0.957	Mitogen-activated protein kinase 3
3	9606.ENSP00000229795	0.948	Mitogen-activated protein kinase 14
4	9606.ENSP00000361014	0.939	MAP kinase-interacting serine/threonine-protein kinase 1
5	9606.ENSP00000364907	0.936	Tyrosine-protein kinase SYK
6	9606.ENSP00000428924	0.932	Tyrosine-protein kinase Lyn
7	9606.ENSP00000302486	0.931	Dual specificity mitogen-activated protein kinase kinase 1
8	9606.ENSP00000363512	0.928	Arachidonate 5-lipoxygenase
9	9606.ENSP00000356438	0.915	Prostaglandin G/H synthase 2
10	9606.ENSP00000333685	0.913	Mitogen-activated protein kinase 11
11	9606.ENSP00000289902	0.908	High affinity immunoglobulin epsilon receptor subunit gamma
12	9606.ENSP00000262948	0.904	Dual specificity mitogen-activated protein kinase kinase 2
13	9606.ENSP00000278888	0.900	High affinity immunoglobulin epsilon receptor subunit beta
14	9606.ENSP00000357097	0.900	High affinity immunoglobulin epsilon receptor subunit alpha
15	9606.ENSP00000274793	0.894	Platelet-activating factor acetylhydrolase
16	9606.ENSP00000354612	0.889	Prostaglandin G/H synthase 1
17	9606.ENSP00000346032	0.885	Annexin A2
18	9606.ENSP00000458832	0.856	Arachidonate 15-lipoxygenase
19	9606.ENSP00000251535	0.851	Arachidonate 12-lipoxygenase, 12S-type
20	9606.ENSP00000286548	0.851	Guanine nucleotide-binding protein G(q) subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047498	0.999	calcium-dependent phospholipase A2 activity
GO:0005488	0.991	binding
GO:0005515	0.851	protein binding
GO:0004622	0.471	lysophospholipase activity
GO:0016740	0.312	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0006690	0.975	icosanoid metabolic process
GO:0033559	0.956	unsaturated fatty acid metabolic process
GO:0006650	0.846	glycerophospholipid metabolic process
GO:0072330	0.751	monocarboxylic acid biosynthetic process
GO:0006633	0.732	fatty acid biosynthetic process
GO:0016042	0.731	lipid catabolic process
GO:0048518	0.687	positive regulation of biological process
GO:0044242	0.674	cellular lipid catabolic process
GO:0046456	0.668	icosanoid biosynthetic process
GO:0048522	0.636	positive regulation of cellular process
GO:0046475	0.624	glycerophospholipid catabolic process
GO:0006636	0.623	unsaturated fatty acid biosynthetic process
GO:0006693	0.610	prostaglandin metabolic process
GO:0050896	0.593	response to stimulus
GO:0006807	0.588	nitrogen compound metabolic process
GO:0046457	0.582	prostanoid biosynthetic process
GO:1901564	0.493	organonitrogen compound metabolic process
GO:0051239	0.342	regulation of multicellular organismal process
GO:0001676	0.327	long-chain fatty acid metabolic process
GO:0051716	0.324	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.985	membrane
GO:0005783	0.947	endoplasmic reticulum
GO:0005634	0.867	nucleus
GO:0031090	0.716	organelle membrane
GO:0005794	0.711	Golgi apparatus
GO:0071944	0.687	cell periphery
GO:0031982	0.596	vesicle
GO:0005789	0.455	endoplasmic reticulum membrane
GO:0005886	0.442	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15801	0.999	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	0.999	phospholipase A2.
RHEA:15177	0.471	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	0.471	lysophospholipase.
EC:2.-.-.-	0.312	Transferases.

[back to server]