StarFunc result for job id P47736

User Input

>input (663 residues)
MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTN
HEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDV
IGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRL
IVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFR
GGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDE
NTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPE
FQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIV
PGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQ
SSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGT
PHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ
LGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2ALS5	0.738	0.738	0.000	663	0.965	0.965	A2ALS5.pdb.gz	RPGP1_MOUSE Rap1 GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rap1gap PE=1 SV=2
2	AFDB:F1LV89	0.689	0.610	0.000	753	0.967	0.851	F1LV89.pdb.gz	F1LV89_RAT Rap1 GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Rap1gap PE=1 SV=3
3	AFDB:Q86RS9	0.548	0.492	1.593E-57	741	0.371	0.332	Q86RS9.pdb.gz	Q86RS9_CAEEL Rap1GAP (Fragment) OS=Caenorhabditis elegans OX=6239 PE=1 SV=1
4	AFDB:Q54Q75	0.449	0.774	3.797E-36	366	0.192	0.347	Q54Q75.pdb.gz	Q54Q75_DICDI RapGAP/RanGAP domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284065 PE=4 SV=1
5	AFDB:A0A2R8RNK4	0.476	0.195	2.295E-34	1718	0.265	0.102	A0A2R8RNK4.pdb.gz
6	AFDB:O43166	0.481	0.186	3.219E-33	1804	0.267	0.098	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
7	AFDB:O35412	0.485	0.184	1.838E-32	1822	0.284	0.103	O35412.pdb.gz	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
8	PDB:7dl2B	0.226	0.153	1.083E-11	1042	0.086	0.055	7dl2B.pdb.gz
9	PDB:7dl2A	0.236	0.149	1.084E-10	1127	0.086	0.051	7dl2A.pdb.gz
10	AFDB:Q9VW83	0.269	0.107	5.215E-6	1847	0.090	0.032	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
11	AFDB:P25558	0.154	0.072	3.156E-3	1636	0.122	0.050	P25558.pdb.gz	BUD3_YEAST Bud site selection protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD3 PE=1 SV=2
12	PDB:7b9kA	0.087	0.146	3.563E-2	320	0.048	0.100	7b9kA.pdb.gz
13	PDB:5c2lA	0.100	0.148	8.276E-2	349	0.054	0.103	5c2lA.pdb.gz	Binding and mimicking of the phosphate-rich substrate, PRPP
14	PDB:6h60A	0.065	0.146	1.226E-1	233	0.027	0.077	6h60A.pdb.gz
15	PDB:5yhvA	0.060	0.087	1.923E-1	394	0.020	0.033	5yhvA.pdb.gz	Crystal structure of an aminotransferase from Mycobacterium tuberculosis
16	PDB:2ewvA	0.083	0.126	2.276E-1	343	0.047	0.090	2ewvA.pdb.gz	Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
17	PDB:6smrA	0.059	0.075	3.372E-1	473	0.026	0.036	6smrA.pdb.gz	Structural basis of methotrexate and pemetrexed action on serine hydroxymethyltransferases revealed using plant models.
18	AFDB:Q27J81	0.054	0.035	3.540E-1	1249	0.074	0.039	Q27J81.pdb.gz	INF2_HUMAN Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2
19	PDB:4rerA	0.061	0.077	4.466E-1	459	0.023	0.033	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:6h55A	0.062	0.150	5.286E-1	233	0.015	0.043	6h55A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GV05	0.0	626	771	0.517	0.445	A0A1B0GV05_HUMAN RAP1 GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=RAP1GAP2 PE=1 SV=1
2	A0A8I5ZN32	0.0	1143	698	0.866	0.822	A0A8I5ZN32_RAT Rap1 GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Rap1gap PE=4 SV=1
3	A0A8I6AU92	0.0	1332	694	0.967	0.924	A0A8I6AU92_RAT Rap1 GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Rap1gap PE=4 SV=1
4	A2ALS5	0.0	1261	663	0.965	0.965	RPGP1_MOUSE Rap1 GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rap1gap PE=1 SV=2
5	F1LV89	0.0	1248	753	0.967	0.851	F1LV89_RAT Rap1 GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Rap1gap PE=1 SV=3
6	P47736	0.0	1372	663	1.000	1.000	RPGP1_HUMAN Rap1 GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RAP1GAP PE=1 SV=2
7	Q5SVL6	0.0	621	712	0.523	0.487	RPGP2_MOUSE Rap1 GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Rap1gap2 PE=1 SV=1
8	Q684P5	0.0	625	730	0.517	0.470	RPGP2_HUMAN Rap1 GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=RAP1GAP2 PE=1 SV=2
9	O44090	6.26e-154	468	850	0.344	0.268	O44090_DROME GTPase activating protein for Rap1 OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=2 SV=1
10	Q9VM02	3.41e-153	466	850	0.342	0.267	Q9VM02_DROME Rap GTPase activating protein 1, isoform E OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
11	Q59DZ5	6.01e-153	466	876	0.342	0.259	Q59DZ5_DROME Rap GTPase activating protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
12	Q9VM00	7.53e-153	467	933	0.342	0.243	Q9VM00_DROME Rap GTPase activating protein 1, isoform D OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
13	A8DYW8	3.31e-152	466	959	0.342	0.237	A8DYW8_DROME Rap GTPase activating protein 1, isoform H OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
14	Q86RS9	2.05e-144	439	741	0.342	0.306	Q86RS9_CAEEL Rap1GAP (Fragment) OS=Caenorhabditis elegans OX=6239 PE=1 SV=1
15	H2L055	8.57e-140	430	811	0.320	0.261	H2L055_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53A10.2 PE=1 SV=1
16	Q5EB70	2.28e-127	379	275	0.345	0.833	Q5EB70_RAT Rap1gap protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Rap1gap PE=2 SV=1
17	X2JF15	2.58e-76	269	1630	0.211	0.086	X2JF15_DROME Radish, isoform L OS=Drosophila melanogaster OX=7227 GN=rsh PE=4 SV=1
18	X2JEQ0	2.74e-76	269	1651	0.211	0.085	X2JEQ0_DROME Radish, isoform K OS=Drosophila melanogaster OX=7227 GN=rsh PE=4 SV=1
19	X2JBI1	2.79e-76	269	1653	0.211	0.085	X2JBI1_DROME Radish, isoform M OS=Drosophila melanogaster OX=7227 GN=rsh PE=4 SV=1
20	X2JDH0	3.54e-76	268	1799	0.211	0.078	X2JDH0_DROME Radish, isoform I OS=Drosophila melanogaster OX=7227 GN=rsh PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02188 GoLoco	0.0004	31.1	GoLoco motif
2	PF02145 Rap_GAP	4.7e-60	213.8	Rap/ran-GAP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000434033

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250559	0.995	Ras-related protein Rap-1b
2	9606.ENSP00000358723	0.990	Ras-related protein Rap-1A
3	9606.ENSP00000347942	0.866	Proto-oncogene tyrosine-protein kinase receptor Ret
4	9606.ENSP00000382428	0.819	Disks large homolog 4
5	9606.ENSP00000421922	0.760	Alpha-2-macroglobulin receptor-associated protein
6	9606.ENSP00000361120	0.708	Ral guanine nucleotide dissociation stimulator
7	9606.ENSP00000313423	0.684	GDNF family receptor alpha-4
8	9606.ENSP00000375960	0.683	Afadin
9	9606.ENSP00000480359	0.674	PDZ and LIM domain protein 5
10	9606.ENSP00000395708	0.670	Rap guanine nucleotide exchange factor 3
11	9606.ENSP00000380271	0.669	Rap guanine nucleotide exchange factor 4
12	9606.ENSP00000245304	0.667	Ras-related protein Rap-2a
13	9606.ENSP00000428518	0.642	GDNF family receptor alpha-2
14	9606.ENSP00000347591	0.635	GDNF family receptor alpha-1
15	9606.ENSP00000335029	0.627	Ras GTPase-activating protein 3
16	9606.ENSP00000262494	0.618	Guanine nucleotide-binding protein G(o) subunit alpha
17	9606.ENSP00000409007	0.614	Glial cell line-derived neurotrophic factor
18	9606.ENSP00000274721	0.612	GDNF family receptor alpha-3
19	9606.ENSP00000347244	0.609	Intersectin-2
20	9606.ENSP00000361263	0.608	Rap guanine nucleotide exchange factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.933	molecular function regulator activity
GO:0030695	0.919	GTPase regulator activity
GO:0140677	0.909	molecular function activator activity
GO:0008047	0.600	enzyme activator activity
GO:0005096	0.579	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0048519	0.977	negative regulation of biological process
GO:0065009	0.971	regulation of molecular function
GO:0048523	0.963	negative regulation of cellular process
GO:0009987	0.956	cellular process
GO:0023052	0.869	signaling
GO:0007154	0.865	cell communication
GO:0007165	0.861	signal transduction
GO:0051128	0.771	regulation of cellular component organization
GO:0120035	0.737	regulation of plasma membrane bounded cell projection organization
GO:0048518	0.592	positive regulation of biological process
GO:0048522	0.488	positive regulation of cellular process
GO:0009966	0.358	regulation of signal transduction
GO:0050793	0.324	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043229	0.999	intracellular organelle
GO:0005829	0.999	cytosol
GO:0043227	0.997	membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0071944	0.960	cell periphery
GO:0005886	0.952	plasma membrane
GO:0031982	0.935	vesicle
GO:0031410	0.902	cytoplasmic vesicle
GO:0042995	0.885	cell projection
GO:0120025	0.876	plasma membrane bounded cell projection
GO:0043005	0.870	neuron projection
GO:0036477	0.786	somatodendritic compartment
GO:0005768	0.750	endosome
GO:0030425	0.540	dendrite
GO:0005769	0.439	early endosome
GO:0043025	0.398	neuronal cell body
GO:0030424	0.369	axon
GO:0043232	0.305	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]